DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and Lrp10

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_075369.2 Gene:Lrp10 / 65107 MGIID:1929480 Length:713 Species:Mus musculus


Alignment Length:116 Identity:32/116 - (27%)
Similarity:46/116 - (39%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDE--------------PRFCTRCNRT---YYG--- 258
            |...||.|.|.||:|.::.|:.::.|||||||              |.....||.|   :||   
Mouse   141 CLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFS 205

  Fly   259 DIGQTYALELHRPKQDRVPFVCV------------LTFTAAGGQHGDVVQV 297
            ..|.::...:..|:.      |:            :.|||....:||.|.|
Mouse   206 SPGYSHLASVSHPQS------CLWLLDPHDGRRLAVRFTALDLSYGDAVHV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 14/30 (47%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
Lrp10NP_075369.2 CUB 35..135 CDD:238001
LDLa 141..175 CDD:238060 16/33 (48%)
CUB 193..303 CDD:238001 15/64 (23%)
LDLa <331..354 CDD:238060
LDLa 400..434 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..636
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.