DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and ldlrad3

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_001124079.1 Gene:ldlrad3 / 570705 ZFINID:ZDB-GENE-030131-1533 Length:314 Species:Danio rerio


Alignment Length:130 Identity:40/130 - (30%)
Similarity:52/130 - (40%) Gaps:45/130 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LGPGKPVNLQLAP-GSSSTGCSL-AEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFC----TRCN 253
            ||.|. |:.|::| |:||..||. ..|.|::|.|||.:..|:...||.|.||| |.|    ::|.
Zfish     8 LGSGS-VDCQVSPGGNSSWHCSAPGSFMCADGECVPAAGQCDGYPDCADRSDE-RGCLKLKSKCA 70

  Fly   254 RTYYGDIGQTYALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGCPDG 318
            .|:                           |:.|.|.|          ..||||.......||||
Zfish    71 STF---------------------------FSCANGVH----------CIIGRFQCNGFRDCPDG 98

  Fly   319  318
            Zfish    99  98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 13/31 (42%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
ldlrad3NP_001124079.1 LDLa 30..62 CDD:238060 14/32 (44%)
LDLa 69..104 CDD:238060 14/67 (21%)
LDLa 111..145 CDD:238060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.