DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and lrp10

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_688859.4 Gene:lrp10 / 560361 ZFINID:ZDB-GENE-140418-2 Length:748 Species:Danio rerio


Alignment Length:294 Identity:64/294 - (21%)
Similarity:100/294 - (34%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 NLQL--APGSSSTGCSLAE---FSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTY----- 256
            |.||  ..|:....|::.:   |.|.:.|||..|..|:...||.||:||    ..|..|.     
Zfish   410 NYQLNCPDGTDERECTICQPGTFHCDSDRCVFESWRCDGQVDCKDGTDE----LNCTATLPRKVI 470

  Fly   257 -YGDIGQTYALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTI-----GRFTSYVHEGC 315
             ...:|.               .||.|....|.|....:..:....:::     .:....:.:..
Zfish   471 TAATVGS---------------LVCGLLLVIAMGCTCKLYSLRTREYSLFAPITRQEAELIQQQA 520

  Fly   316 PDGYMQ-IAESARTPIGGMWCGSSWGPVLFYSETRSLIFTIR-LNRLARDQSGYNFDFRIRYKVL 378
            |..|.| ||:....|:...       |....:||.||  ::| :.:|.|..:..:...|.|.:.:
Zfish   521 PPSYGQLIAQGIIPPVEDF-------PTENPNETVSL--SLRGILQLLRQDNASSLRRRRRPRFV 576

  Fly   379 SRD-SSVTRYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQQQQGAPGILEDFTNSSVARSDR 442
            .|. ..:.|:|.|..|........:|    ..||.:......|..|.:||.      ||||    
Zfish   577 RRAVRRLRRWGLIPRATSRPTQTTAS----SSQQTEAANSSTQPSQSSPGA------SSVA---- 627

  Fly   443 YGQDFSLFSAYANNKTFMASLEKSLAKDEQNYTE 476
                         .:.|..||.:.|...:|..|:
Zfish   628 -------------TEAFSQSLTQKLGLSQQTETQ 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/33 (36%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
lrp10XP_688859.4 CUB 36..136 CDD:238001
LDLa 142..181 CDD:238060
CUB 229..334 CDD:294042
LDLa 427..461 CDD:238060 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.