DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and CD320

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_057663.1 Gene:CD320 / 51293 HGNCID:16692 Length:282 Species:Homo sapiens


Alignment Length:287 Identity:64/287 - (22%)
Similarity:93/287 - (32%) Gaps:107/287 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LTLLLCLGISLGMAATAAAAGGGGGGGGGAAPVSGSGAAGFPSSSSSISSSLGPGKPVNLQLAPG 208
            |.|||.||:.||:.|.|:                       |.|:.:.:.:.||           
Human    19 LALLLLLGLGLGLEAAAS-----------------------PLSTPTSAQAAGP----------- 49

  Fly   209 SSSTGCSLAEFSC-SNGRCVPLSKYCNNLNDCGDGSDEPRF----CTRCNRTYYGDIGQTYALEL 268
             ||..|...:|.| ::|.||||:..|:...||.|||||...    ||:        .||.     
Human    50 -SSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQ--------KGQC----- 100

  Fly   269 HRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGC-P-----DGYMQIAESAR 327
              |....:|..|......:||....:...:..:...|.....:.:.| |     ||:....:|: 
Human   101 --PPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSS- 162

  Fly   328 TPIGGMWCG----------SSWGPVLFYSETRSLIFTIRL----------------NRLARDQSG 366
               ..:.||          ::.||.:......||.....:                :..|.||||
Human   163 ---DELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSG 224

  Fly   367 YNFDFRIRYKVLSRDSSVTRYGGIKLA 393
                            |.|.||.|..|
Human   225 ----------------SPTAYGVIAAA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 14/31 (45%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
CD320NP_057663.1 LDLa 54..89 CDD:238060 16/34 (47%)
LDLa 132..167 CDD:238060 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.