| Sequence 1: | NP_649266.1 | Gene: | CG32432 / 40310 | FlyBaseID: | FBgn0052432 | Length: | 1307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524849.2 | Gene: | ImpE1 / 45879 | FlyBaseID: | FBgn0001253 | Length: | 1616 | Species: | Drosophila melanogaster |
| Alignment Length: | 41 | Identity: | 19/41 - (46%) |
|---|---|---|---|
| Similarity: | 23/41 - (56%) | Gaps: | 2/41 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 208 GSSSTG--CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEP 246 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32432 | NP_649266.1 | LDLa | 214..245 | CDD:197566 | 13/30 (43%) |
| CUB | 503..646 | CDD:238001 | |||
| LDLa | 1203..1231 | CDD:197566 | |||
| ImpE1 | NP_524849.2 | EB | 75..131 | CDD:460294 | |
| rne | <795..981 | CDD:236766 | |||
| LDLa | 1404..1437 | CDD:238060 | |||
| LDLa | 1448..1483 | CDD:238060 | |||
| LDLa | 1493..1524 | CDD:238060 | 13/30 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||