DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and ImpE1

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_524849.2 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster


Alignment Length:41 Identity:19/41 - (46%)
Similarity:23/41 - (56%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GSSSTG--CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEP 246
            ||...|  |....|.|.:|.|:|..:|||.:..|.||||||
  Fly  1485 GSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKDGSDEP 1525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 13/30 (43%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
ImpE1NP_524849.2 EB 75..131 CDD:460294
rne <795..981 CDD:236766
LDLa 1404..1437 CDD:238060
LDLa 1448..1483 CDD:238060
LDLa 1493..1524 CDD:238060 13/30 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.