DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and arr

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_524737.2 Gene:arr / 44279 FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster


Alignment Length:771 Identity:144/771 - (18%)
Similarity:230/771 - (29%) Gaps:311/771 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 KDKKFEPRLKTWNYCDYIQENVKPKWKSTDYVTVYDGYTTRDPII--LKFCGG----GQAVPAAV 626
            |..:.||:|     |..|..|.....|:|.......|...|..:|  |..|.|    .|.....:
  Fly     8 KSAEIEPQL-----CQVIDNNEDVTTKATKCTKSNSGVGWRQMLIGFLLICFGISNSWQYKNVHM 67

  Fly   627 SSGPELLVEFSTSPFGTFTGTSSQVLPLYGFQLEVEVQFVDIQSPT------------------- 672
            .|...|:   ::.|...|..|.:.:|    |....::|..:|..||                   
  Fly    68 PSSSSLI---ASPPASAFVNTPATLL----FTTRHDIQVANITRPTGGPQIDVIVRDLAEAMAID 125

  Fly   673 --YSKNKKPCEFWIRGAGRGILESPKHSLAPNSTCLYHLQGLGVFKTFDHLSLSRRTSSQSGMHQ 735
              |:|| ..|  | ..:||.|:|..:    .||:.|..|           |...::|...:|:.:
  Fly   126 FYYAKN-LVC--W-TDSGREIIECAQ----TNSSALQPL-----------LRAPKQTVISTGLDK 171

  Fly   736 PLSRFKVWISVLKFNLDPEFGQIDETSVGAIGVLQTQEDCSGMLRIWDGTLRDAPVCKDLNCATE 800
            |......|.:...:..|.|..:|:         :.|.:.....:..|  |..|.|....:..|.:
  Fly   172 PEGLAMDWYTDKIYWTDGEKNRIE---------VATLDGRYQKVLFW--TDLDQPRAVAVVPARK 225

  Fly   801 TSSYNTLGHYTHNSTSVIARFCRGTIPRTCDRSNINETYARPCTISESYVSTSDAITLELRNTES 865
            ...:...|.|                |: .:|::::.......|:.:.:|...:.:.::|:|   
  Fly   226 LLIWTDWGEY----------------PK-IERASMDGDPLSRMTLVKEHVFWPNGLAVDLKN--- 270

  Fly   866 TVLRPLDFKLKYEFIDLHQDGLPWGGGEHDCNRKFLSSMMDRKDPAIFRSVRNIFLFGRGGTRNL 930
                    :|.|           |..|:|    .|:..|  |.|.:..|::.|          ||
  Fly   271 --------ELIY-----------WTDGKH----HFIDVM--RLDGSSRRTIVN----------NL 300

  Fly   931 KC----------IYKFEAQRGE------RVRIKMRKVTTTNRPCYSRV-DEDINRSFCYGDTNVR 978
            |.          :|..:.|||.      :.|.....:.|...|...|. |..:            
  Fly   301 KYPFSLTFYDDRLYWTDWQRGSLNALDLQTRELKELIDTPKAPNSVRAWDPSL------------ 353

  Fly   979 IEIFERPYHDSILLHRGCMCNSSNQSHLPVEYTST--------------------SRDVEVHFIA 1023
                 :||.|:     .|..|:.|.|||.:..|::                    :...|:.||.
  Fly   354 -----QPYEDN-----PCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISANTCANGSQEMMFIV 408

  Fly  1024 Q----NMTTLDDPD---------------TVNFEGMFEFV--------KAPTSCKDGRRKFGPSG 1061
            |    :..:||.||               .::::.:.|.:        ....:..||      :|
  Fly   409 QRTQISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADG------TG 467

  Fly  1062 TIDMTFGDV---ECRSRPWLIEPSNGNKFLYVRLKAIFLSKHNPTQTLNATYVQTDTWRCETKSR 1123
            ..|....:|   :..:..||..                          |..:..|.|.|.|    
  Fly   468 VTDFVTSEVRHPDGLALDWLAR--------------------------NLYWTDTVTDRIE---- 502

  Fly  1124 AVLTTSEGLTIVACPLSPDSNA-----YEFVE-------------IFSSGWNER----PNFALVN 1166
                        .|.|  |..|     ||.:|             :|.|.||||    ...:|..
  Fly   503 ------------VCRL--DGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNERKPKVERASLDG 553

  Fly  1167 RSRAISV-EFLRPGNGEYSFNWMELIPRPTLSMAEDCQFKCAELGACVNASVWCDG 1221
            ..|.:.| |.|...||                :|.|.:.|         |..||||
  Fly   554 SERVVLVSENLGWPNG----------------IALDIEAK---------AIYWCDG 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566
CUB 503..646 CDD:238001 20/83 (24%)
LDLa 1203..1231 CDD:197566 6/19 (32%)
arrNP_524737.2 LY 162..201 CDD:214531 8/47 (17%)
NHL 168..503 CDD:302697 74/470 (16%)
NHL repeat 172..237 CDD:271320 13/91 (14%)
LY 252..293 CDD:214531 13/68 (19%)
NHL repeat 261..298 CDD:271320 12/64 (19%)
NHL repeat 303..339 CDD:271320 5/35 (14%)
NHL repeat 341..419 CDD:271320 17/99 (17%)
NHL repeat 428..476 CDD:271320 5/53 (9%)
LY 472..511 CDD:214531 11/82 (13%)
NHL repeat 477..503 CDD:271320 7/67 (10%)
Ldl_recept_b 534..573 CDD:278487 14/54 (26%)
LY 558..599 CDD:214531 13/52 (25%)
LY 600..641 CDD:214531
FXa_inhibition 668..703 CDD:291342
LY 739..773 CDD:214531
LY 776..818 CDD:214531
LY 819..860 CDD:214531
FXa_inhibition 973..1010 CDD:291342
LY 1122..1164 CDD:214531
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.