DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and LRP6

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_001401173.1 Gene:LRP6 / 4040 HGNCID:6698 Length:1644 Species:Homo sapiens


Alignment Length:316 Identity:63/316 - (19%)
Similarity:93/316 - (29%) Gaps:122/316 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPF 278
            |.:.:|.|:||:|:...|.|::..||.|.|||                    |:.: |.::..| 
Human  1357 CLIDQFRCANGQCIGKHKKCDHNVDCSDKSDE--------------------LDCY-PTEEPAP- 1399

  Fly   279 VCVLTFTAAGGQHGDVVQVTLDSFTIGRF--------------------TSYVHEG---CPDGYM 320
                   .|....|.|:.|.:..|..|..                    ..||..|   .|.||:
Human  1400 -------QATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYV 1457

  Fly   321 QIAESARTPIGGMWCGSSWGPVLFYSETRSLIFTIRLNRLARDQSGYNFDFRIRYKVLSRDSSVT 385
            ....|....:.||            |..:|:|.::   .:....||..:|   |..|....||  
Human  1458 PHPSSLSGSLPGM------------SRGKSMISSL---SIMGGSSGPPYD---RAHVTGASSS-- 1502

  Fly   386 RYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQQQQGA--PGILEDFTNSSVARSDRYGQDFS 448
                                            .....:|.  |.||....:.:..|| .|..:| 
Human  1503 --------------------------------SSSSTKGTYFPAILNPPPSPATERS-HYTMEF- 1533

  Fly   449 LFSAYANNKTFMASLEKSLAKDEQNYT-EPKYYLGDLIPGTYCSRIFSDCDKKPCR 503
               .|::|.          ....::|: .|..|.....|.|.||....|.|..|.|
Human  1534 ---GYSSNS----------PSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSR 1576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/30 (40%)
CUB 503..646 CDD:238001 1/1 (100%)
LDLa 1203..1231 CDD:197566
LRP6NP_001401173.1 YncE 1..204 CDD:442618
Beta-propeller 1 20..275
LY 89..127 CDD:214531
Ldl_recept_b 150..191 CDD:459654
LY 175..216 CDD:214531
LY 217..251 CDD:214531
LDL-receptor class B 5 237..276
FXa_inhibition 286..323 CDD:464251
Beta-propeller 2 328..589
LY 353..393 CDD:214531
LY 397..437 CDD:214531
Ldl_recept_b 458..499 CDD:459654
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:464251
Beta-propeller 3 631..890
YncE <654..813 CDD:442618
LY 697..739 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:464251
LY 958..998 CDD:214531
YncE <968..1075 CDD:442618
LY 1094..1132 CDD:214531
FXa_inhibition 1238..1274 CDD:464251
LDLa 1280..1316 CDD:238060
LDLa 1319..1353 CDD:238060
LDLa 1357..1391 CDD:238060 15/53 (28%)
PPPSP motif A 1518..1524 0/5 (0%)
PPPSP motif B 1558..1565 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1587..1644
PPPSP motif C 1599..1606
PPPSP motif D 1619..1624
PPPSP motif E 1634..1641
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.