DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and LRP3

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_005259002.1 Gene:LRP3 / 4037 HGNCID:6695 Length:785 Species:Homo sapiens


Alignment Length:509 Identity:110/509 - (21%)
Similarity:154/509 - (30%) Gaps:201/509 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TAAAAGGGGGGGGGAAPVSGSGAAGFPSSSSSISSSLGPGKPVNLQLAPGSSSTGCSLAEFSCSN 223
            |....|.|...|..:||.|..                 ||     .|.||.:        |.||.
Human   187 TVDECGDGSDEGNCSAPASEP-----------------PG-----SLCPGGT--------FPCSG 221

  Fly   224 G---RCVPLSKYCNNLNDCGDGSDE---PRF-CTRCNRTYYGDIGQTYALELHRPKQDRVPFVCV 281
            .   ||:|:.:.|:.|.||||||||   |.. |.|...::||.                  |...
Human   222 ARSTRCLPVERRCDGLQDCGDGSDEAGCPDLACGRRLGSFYGS------------------FASP 268

  Fly   282 LTFTAAGGQ---HGDVVQVTLDS--------FTIGRFTSYVHEGCPDGYMQIAESARTPIGGMWC 335
            ..|.||.|.   |...:..|.||        ..:|.          |.|:|:.|.    :|..  
Human   269 DLFGAARGPSDLHCTWLVDTQDSRRVLLQLELRLGY----------DDYVQVYEG----LGER-- 317

  Fly   336 GSSWGPVLFY-SETRSLIFTIRLNRL-----ARDQS---GYNFDFRIRYKVL--------SRDSS 383
            |......|.| |..|.:.......||     ||.:|   |:|..::::...|        |.||.
Human   318 GDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSDSD 382

  Fly   384 VTRYGGIKLAELAQ-----WHNRSSFLNQQQQQQQQQQQQQQQQQGAPGILEDFTNSSVARSDRY 443
            ....|........|     ||..|.                :.:||.|          ....|:|
Human   383 GGSLGDQGCFSEPQRCDGWWHCASG----------------RDEQGCP----------ACPPDQY 421

  Fly   444 GQDFSLFSAY-----ANNKTFMASLEKSL--AKDEQNYTEPKYYLGDLIPGTYCSRIFSDCDKKP 501
            ..:......|     .||       :||.  ..||:|....:       |||:      .|....
Human   422 PCEGGSGLCYTPADRCNN-------QKSCPDGADEKNCFSCQ-------PGTF------HCGTNL 466

  Fly   502 CRLQSPNFPGIYPRNLTCYYAVRQHDVPHG--KHALILVKQPK-------GNLVW---------- 547
            |..::....|             |.|...|  :|..:.....|       |:||.          
Human   467 CIFETWRCDG-------------QEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGC 518

  Fly   548 ------ISTQE--TAAANKMAPPPSASDKDKKFEPRLKTWNYCDYIQENVKPKW 593
                  :.|||  :.||....|||:||   :.||.:: |....::::....|.:
Human   519 AFKLYSLRTQEYRSRAAQSCRPPPTAS---RAFETQM-TRLEAEFVRREAPPSY 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 14/33 (42%)
CUB 503..646 CDD:238001 23/118 (19%)
LDLa 1203..1231 CDD:197566
LRP3XP_005259002.1 CUB 43..156 CDD:238001
LDLa 166..200 CDD:238060 4/12 (33%)
LDLa 212..249 CDD:238060 18/44 (41%)
CUB 254..364 CDD:238001 31/143 (22%)
LDLa 416..452 CDD:238060 9/42 (21%)
LDLa 455..489 CDD:238060 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.