DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and cue

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_612113.2 Gene:cue / 38174 FlyBaseID:FBgn0011204 Length:644 Species:Drosophila melanogaster


Alignment Length:405 Identity:71/405 - (17%)
Similarity:119/405 - (29%) Gaps:151/405 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   945 RIKMRKVTTTNRPCYSRVDEDINRSFCYGDTNVRIEIFERPYHDSILLH--------RGCMCNSS 1001
            ::.:.|||||::|    .:||...|..:.|.       |....|..|:.        ||.:..:.
  Fly   273 KVPVIKVTTTSKP----DEEDSTDSTDFKDP-------EPVAEDCPLVRVANLSEEARGIVARTG 326

  Fly  1002 NQSHLPVEY-------------TSTSRDVEVH-FIAQNMTTLDDPDTVN---FEGMFEFVKAPTS 1049
            ....|..::             ...||..|:. .:.|.:..|:|...:|   :....:....||.
  Fly   327 FYQRLQKDHHCASIVRKVKERVDEQSRKFEIRSLLDQKIKVLEDERCMNDGEYRAATDLCICPTG 391

  Fly  1050 CKDGR------RKFGPSGTIDMT-FGDVECRSRPWLIEPSNGNKFLYVRLKAIFLSKHNPTQTLN 1107
            .|..|      ..:...||..|: ....:|..:|..    .|.                      
  Fly   392 FKGSRCEIRECHNYCVHGTCQMSELAYPKCYCQPGF----KGE---------------------- 430

  Fly  1108 ATYVQTDTWRCETKSRAVLTTSEGLTIVA--CPLSPDSNAYEFVEIFSSGWNERPNFALVNRSRA 1170
                     |||      |:...||.:..  |.:|.|.             ||.|       |..
  Fly   431 ---------RCE------LSVCSGLCLNGGHCRVSKDE-------------NEAP-------SCE 460

  Fly  1171 ISVEFLRPGNGEYSFNWMELIP--------RPTLSMAEDCQFKCAELG----------------A 1211
            ...:|   |......|..|:..        .|.:.:...|...|.||.                .
  Fly   461 CPAKF---GGARCEQNSTEICSLFCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAIPQYQHLEV 522

  Fly  1212 CVNASVWCDGVVHCPSGDDETFLQCSALMKLPAEILATLCLIFVLSCCAFAAFAYKKIKRKLRGS 1276
            |:...||...|:                :.|...|:::|.|:.|:  .......||..:.::|.:
  Fly   523 CLTPRVWTSSVI----------------IILVVGIVSSLLLVAVI--VQGIRRLYKPKRPRIRKT 569

  Fly  1277 SVLQTRLKSLSSMDT 1291
            .|::.:.::.|:.||
  Fly   570 FVVRKQARTNSAGDT 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566 7/43 (16%)
cueNP_612113.2 LY 101..141 CDD:214531
Ldl_recept_b 167..208 CDD:278487
LY 193..237 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.