| Sequence 1: | NP_649266.1 | Gene: | CG32432 / 40310 | FlyBaseID: | FBgn0052432 | Length: | 1307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006238632.1 | Gene: | Lrp8 / 362558 | RGDID: | 1305729 | Length: | 1013 | Species: | Rattus norvegicus |
| Alignment Length: | 216 | Identity: | 49/216 - (22%) |
|---|---|---|---|
| Similarity: | 61/216 - (28%) | Gaps: | 98/216 - (45%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 139 PLPATLTLLLCLGISLGMAATAAAAGGGGGGGGGAAPVSGSGAAGFPSSSSSISSSLGPGKPVNL 203
Fly 204 QLAPGSSSTGCSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDE----PRFCTRCNRTYYGDIGQTY 264
Fly 265 ALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGCPDGYMQ---IAESA 326
Fly 327 RTPIGGMWCG--------SSW 339 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32432 | NP_649266.1 | LDLa | 214..245 | CDD:197566 | 13/30 (43%) |
| CUB | 503..646 | CDD:238001 | |||
| LDLa | 1203..1231 | CDD:197566 | |||
| Lrp8 | XP_006238632.1 | LDLa | 44..78 | CDD:238060 | 15/33 (45%) |
| LDLa | 82..114 | CDD:197566 | 11/72 (15%) | ||
| LDLa | 124..160 | CDD:238060 | 5/20 (25%) | ||
| LDLa | 203..235 | CDD:197566 | |||
| LDLa | 256..289 | CDD:238060 | |||
| LDLa | 295..329 | CDD:238060 | |||
| LDLa | 333..369 | CDD:294076 | |||
| FXa_inhibition | 390..424 | CDD:291342 | |||
| EGF_CA | 426..456 | CDD:214542 | |||
| LY | 495..530 | CDD:214531 | |||
| LY | 540..581 | CDD:214531 | |||
| Ldl_recept_b | 602..642 | CDD:278487 | |||
| LY | 626..668 | CDD:214531 | |||
| Ldl_recept_b | 689..728 | CDD:278487 | |||
| FXa_inhibition | 747..784 | CDD:291342 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||