DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and Lrp6

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_017448147.1 Gene:Lrp6 / 312781 RGDID:1304749 Length:1613 Species:Rattus norvegicus


Alignment Length:314 Identity:65/314 - (20%)
Similarity:95/314 - (30%) Gaps:118/314 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPF 278
            |.:.:|.|:||:||...|.|::..||.|.|||                    |:.: |.::..| 
  Rat  1326 CLIDQFRCANGQCVGKHKKCDHNVDCSDRSDE--------------------LDCY-PTEEPAP- 1368

  Fly   279 VCVLTFTAAGGQHGDVVQVTLDSFTIGRF--------------------TSYVHEG---CPDGYM 320
                   .|....|.|:.|.:..|..|..                    ..||..|   .|.||:
  Rat  1369 -------QATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYV 1426

  Fly   321 QIAESARTPIGGMWCGSSWGPVLFYSETRSLIFTIRLNRLARDQSGYNFDFRIRYKVLSRDSSVT 385
            ....|....:.||            |..:|:|.::   .:....||..:| |......|..||.:
  Rat  1427 PHPSSLSGSLPGM------------SRGKSMISSL---SIMGGSSGPPYD-RAHVTGASSSSSSS 1475

  Fly   386 RYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQQQQGAPGILEDFTNSSVARSDRYGQDFSLF 450
            ..|             :.|                     |.||....:.:..|| .|..:|   
  Rat  1476 TKG-------------TYF---------------------PAILNPPPSPATERS-HYTMEF--- 1502

  Fly   451 SAYANNKTFMASLEKSLAKDEQNYT-EPKYYLGDLIPGTYCSRIFSDCDKKPCR 503
             .|::|.          ....::|: .|..|.....|.|.||....|.|..|.|
  Rat  1503 -GYSSNS----------PSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSR 1545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 13/30 (43%)
CUB 503..646 CDD:238001 1/1 (100%)
LDLa 1203..1231 CDD:197566
Lrp6XP_017448147.1 NHL 55..272 CDD:302697
NHL repeat 55..93 CDD:271320
LY 89..127 CDD:214531
NHL repeat 97..132 CDD:271320
NHL repeat 140..176 CDD:271320
Ldl_recept_b 150..190 CDD:278487
LY 175..216 CDD:214531
NHL repeat 181..217 CDD:271320
NHL repeat 226..253 CDD:271320
FXa_inhibition 286..323 CDD:291342
LY 353..393 CDD:214531
LY 397..437 CDD:214531
LY 438..481 CDD:214531
LY 483..524 CDD:214531
LY 525..558 CDD:214531
FXa_inhibition 592..627 CDD:291342
LY 656..694 CDD:214531
LY 697..739 CDD:214531
LY 740..783 CDD:214531
LY 783..825 CDD:214531
LY 827..866 CDD:214531
FXa_inhibition 893..929 CDD:291342
LY 958..998 CDD:214531
LY 1001..1048 CDD:214531
Ldl_recept_b 1069..1110 CDD:278487
LY 1094..1136 CDD:214531
FXa_inhibition 1207..1243 CDD:291342
LDLa 1249..1285 CDD:238060
LDLa 1288..1322 CDD:238060
LDLa 1326..1360 CDD:238060 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.