| Sequence 1: | NP_649266.1 | Gene: | CG32432 / 40310 | FlyBaseID: | FBgn0052432 | Length: | 1307 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_501228.1 | Gene: | F32E10.8 / 260105 | WormBaseID: | WBGene00017995 | Length: | 134 | Species: | Caenorhabditis elegans |
| Alignment Length: | 50 | Identity: | 17/50 - (34%) |
|---|---|---|---|
| Similarity: | 24/50 - (48%) | Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 203 LQLAPGSSSTGCSLAEFSCS-NGRCVPLSKYCNNLNDCGDGSDEPRFCTR 251 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32432 | NP_649266.1 | LDLa | 214..245 | CDD:197566 | 10/31 (32%) |
| CUB | 503..646 | CDD:238001 | |||
| LDLa | 1203..1231 | CDD:197566 | |||
| F32E10.8 | NP_501228.1 | LDLa | <40..61 | CDD:238060 | |
| LDLa | 84..117 | CDD:197566 | 10/32 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||