DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and F32E10.8

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_501228.1 Gene:F32E10.8 / 260105 WormBaseID:WBGene00017995 Length:134 Species:Caenorhabditis elegans


Alignment Length:50 Identity:17/50 - (34%)
Similarity:24/50 - (48%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LQLAPGSSSTGCSLAEFSCS-NGRCVPLSKYCNNLNDCGDGSDEPRFCTR 251
            |||...|....|....|.|: :..|:..::.|:...||.|||||...|.:
 Worm    74 LQLQDVSVGLKCPSFWFRCTDSSSCIAPNRVCDKYKDCRDGSDERENCNQ 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 10/31 (32%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
F32E10.8NP_501228.1 LDLa <40..61 CDD:238060
LDLa 84..117 CDD:197566 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.