DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and EGF

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_016863334.1 Gene:EGF / 1950 HGNCID:3229 Length:1223 Species:Homo sapiens


Alignment Length:420 Identity:78/420 - (18%)
Similarity:127/420 - (30%) Gaps:185/420 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SSSSISSSLGPGKPVNLQLAP--------GSSSTGCSLAEFSCSNGRCVPLSKY---CNNLNDCG 240
            |...:.:|.||     |...|        |.:.:|||..:....:..|||||..   |    ||.
Human   417 SHDCVLTSEGP-----LCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWEC----DCF 472

  Fly   241 DGSD---EPRFCT-------------------RCNRTYYG-----DIGQTYALELHRPKQDRVPF 278
            .|.|   :.:.|.                   ..:.|.||     .:|..|||: |.|.::::.|
Human   473 PGYDLQLDEKSCAASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALD-HDPVENKIYF 536

  Fly   279 VCVLTFTAA---------GGQHGDVVQVTLDSFTIGRFTSYVHEGCPDGYMQIAESARTPIGGMW 334
                ..||.         |.|...:::..:|              .|:|           :...|
Human   537 ----AHTALKWIERANMDGSQRERLIEEGVD--------------VPEG-----------LAVDW 572

  Fly   335 CGSSWGPVLFY--SETRSLIFTIRLNRLARDQSGYNFDFRIRYKVLSRDSSVTRYGGIKLAELAQ 397
            .|..     ||  ...:|||....||..             |.|::::: ::::..||.:..:|:
Human   573 IGRR-----FYWTDRGKSLIGRSDLNGK-------------RSKIITKE-NISQPRGIAVHPMAK 618

  Fly   398 ---WHNRSSFLNQQQQQQQQQQQQQQQQQGAPGILEDFTNSSVARSDRYGQ-----DFSLFSAYA 454
               |.:..  :|.:.:...               |:......:|.||....     ||       
Human   619 RLFWTDTG--INPRIESSS---------------LQGLGRLVIASSDLIWPSGITIDF------- 659

  Fly   455 NNKTFMASLEKSLAKDEQNYTEPKYYLGDLIPGTYCSRIFSDCDKKPCRLQSPNFPGIYPRNLTC 519
                               .|:..|:                ||.|...::..|..|...|.|| 
Human   660 -------------------LTDKLYW----------------CDAKQSVIEMANLDGSKRRRLT- 688

  Fly   520 YYAVRQHDVPHGKHALILVKQPKGNLVWIS 549
                 |:||.| ..|:.:.:    :.||.|
Human   689 -----QNDVGH-PFAVAVFE----DYVWFS 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 12/36 (33%)
CUB 503..646 CDD:238001 13/47 (28%)
LDLa 1203..1231 CDD:197566
EGFXP_016863334.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.