DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and egg-2

DIOPT Version :10

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_498537.1 Gene:egg-2 / 187510 WormBaseID:WBGene00019811 Length:548 Species:Caenorhabditis elegans


Alignment Length:116 Identity:36/116 - (31%)
Similarity:46/116 - (39%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LAPGSSSTGCSLAEFSCSNG--RCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALE 267
            |.|.:.|| ||...|:|:..  ..:|.||.|:.|.||.|||||.. |..|...|    .....:|
 Worm   115 LLPPNVST-CSGFGFACTGSIDMIIPSSKRCDGLKDCSDGSDEEN-CKECQSIY----SCRAHIE 173

  Fly   268 LHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEGCPDG 318
            ....|:|:..                 |..||...|..:..:.| |.||||
 Worm   174 EESEKKDKTS-----------------VLPTLICLTAEKLCNGV-ENCPDG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 14/32 (44%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
egg-2NP_498537.1 LDLa 123..159 CDD:238060 16/36 (44%)
LDLa 216..251 CDD:238060
LDLa 254..287 CDD:238060
LDLa 300..327 CDD:238060
LDLa 373..411 CDD:238060
LDLa 424..453 CDD:238060
LDLa 456..491 CDD:238060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.