powered by:
Protein Alignment CG32432 and egg-1
DIOPT Version :9
Sequence 1: | NP_649266.1 |
Gene: | CG32432 / 40310 |
FlyBaseID: | FBgn0052432 |
Length: | 1307 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498237.2 |
Gene: | egg-1 / 175804 |
WormBaseID: | WBGene00015083 |
Length: | 551 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 21/57 - (36%) |
Similarity: | 32/57 - (56%) |
Gaps: | 7/57 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 202 NLQLAPGSS-----STGCSLAEFSC-SNGRCVPLSKYCNNLNDCGDGSDEPRFCTRC 252
|::..|..| .:.||..:|.| .:..|:|||..|:.:|||.|.||| :.|::|
Worm 199 NVENCPDGSDEAVCKSSCSKDQFKCPGSNACLPLSAKCDGINDCADASDE-KNCSKC 254
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1215 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.