DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32432 and LDLRAD3

DIOPT Version :9

Sequence 1:	NP_649266.1	Gene:	CG32432 / 40310	FlyBaseID:	FBgn0052432	Length:	1307	Species:	Drosophila melanogaster
Sequence 2:	NP_777562.1	Gene:	LDLRAD3 / 143458	HGNCID:	27046	Length:	345	Species:	Homo sapiens

Alignment Length:	134	Identity:	41/134 - (30%)
Similarity:	52/134 - (38%)	Gaps:	47/134 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   195 LGP-----GKPVNLQLAPGSSSTG-CSL-AEFSCSNGRCVPLSKYCNNLNDCGDGSDE---PRFC 249
            |||     ......||.||::.|. |:: ..|.||||||:|.:..|:.|.||.|.|||   |:..
Human     4 LGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAK 68

  Fly   250 TRCNRTYYGDIGQTYALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEG 314
            ::|..|:                           |..|.|.|          ..||||.....|.
Human    69 SKCGPTF---------------------------FPCASGIH----------CIIGRFRCNGFED 96

  Fly   315 CPDG 318
            ||||
Human    97 CPDG 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32432	NP_649266.1	LDLa	214..245	CDD:197566	15/31 (48%)
		CUB	503..646	CDD:238001
		LDLa	1203..1231	CDD:197566
LDLRAD3	NP_777562.1	LDLa	32..64	CDD:238060	16/31 (52%)
		LDLa	71..106	CDD:238060	15/67 (22%)
		LDLa	113..147	CDD:238060
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	270..345
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1215
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900