DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and Dgcr2

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:NP_034178.2 Gene:Dgcr2 / 13356 MGIID:892866 Length:549 Species:Mus musculus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:89/265 - (33%) Gaps:94/265 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 CSLAEFSCSNG--RCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRV 276
            |:..:|:|..|  :|:||...|:....|.|.|||.. |....    |: .:.|..|....:|.| 
Mouse    30 CNPGQFACHGGTIQCIPLPWQCDGWPTCEDKSDEAD-CPEVT----GE-ARPYGKETVDLRQGR- 87

  Fly   277 PFVCVLTFTAAGGQ--HGDVVQVTLDSFTIGRFTSYVHEGCPDG---YMQIAESARTPIGG--MW 334
                     |.||.  |...|.|....    ||:|::.: ||.|   |...|...|..:.|  .|
Mouse    88 ---------ARGGDPTHFHTVNVAQPV----RFSSFLGK-CPSGWHHYEGTASCYRVYLSGENYW 138

  Fly   335 -----CGSSWGPVLFYSETRSLIFTIRLNRLAR--DQSGYNFDFR--------IRYKVLSRDSSV 384
                 |....|.:..:|..:.|.|.     ||:  ||...:|.::        .:|.:..|:.|:
Mouse   139 DAAQTCQRVNGSLATFSTDQELRFV-----LAQEWDQPERSFGWKDQRKLWVGYQYVITGRNHSL 198

  Fly   385 T---------------------------------------RYGGIKLAELAQWH-----NRSSFL 405
            .                                       .:..::..:|..||     .:||||
Mouse   199 EGRWEVAFKGSPEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCSEKSSFL 263

  Fly   406 NQQQQ 410
            .::.|
Mouse   264 CKRSQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 11/32 (34%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
Dgcr2NP_034178.2 LDLa 30..66 CDD:238060 13/36 (36%)
CLECT_DGCR2_like 114..266 CDD:153069 28/156 (18%)
VWC 270..328 CDD:214564
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.