DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and LOC100536757

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_021334054.1 Gene:LOC100536757 / 100536757 -ID:- Length:600 Species:Danio rerio


Alignment Length:196 Identity:53/196 - (27%)
Similarity:79/196 - (40%) Gaps:51/196 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GGGAAPVS----GSGAAGFPSSSSSI-SSSLGPGKPVNLQLAPG-----------SSSTGCSLAE 218
            |.|:..:|    .:|:....:|.|.: |||:..|:|   ..|.|           |.:..|:.:|
Zfish    64 GDGSDEISCWNCTNGSFHCVASESCVSSSSVCDGRP---DCADGADEQLDTCTSFSQAQPCARSE 125

  Fly   219 FSCSNGRCVPLSKYCNNLNDCGDGSDEPRFCTR---------CNRTYYGDIGQTYALELHRPKQD 274
            |:|:||:|||.|..|::.:||.||||| ..|..         |:.|.   |...:......||..
Zfish   126 FTCTNGQCVPNSWRCDHSSDCKDGSDE-EDCDHNECAVNNGGCSHTC---IDLPFGFRCDCPKGM 186

  Fly   275 RVPFVCVLTFTAAGGQHGDVVQVTLDSFTIGRFTSYVHEG------CPDGYMQIAESAR-TPIGG 332
            |:          ....|.:||...||:....:..  ||..      |.|||...|.:.: ...||
Zfish   187 RL----------VQDTHCEVVDQCLDADVCDQIC--VHSNGSVVCDCQDGYQLTAGTGQCRATGG 239

  Fly   333 M 333
            :
Zfish   240 L 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 16/30 (53%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
LOC100536757XP_021334054.1 LDLa 38..72 CDD:238060 2/7 (29%)
PRKCSH-like <45..>112 CDD:193472 13/50 (26%)
LDLa 121..155 CDD:238060 18/34 (53%)
FXa_inhibition 160..193 CDD:317114 6/45 (13%)
Ldl_recept_b 367..407 CDD:278487
LY 393..433 CDD:214531
LY 434..476 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.