DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and ZFY

DIOPT Version :9

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001356631.1 Gene:ZFY / 7544 HGNCID:12870 Length:801 Species:Homo sapiens


Alignment Length:427 Identity:97/427 - (22%)
Similarity:158/427 - (37%) Gaps:87/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VYVCSLCLRQYDLQEDLRGHLVYFHGYEPISTPSVKNKTAKTSTKEQ--TAAGSNSQDKQTVVER 70
            ||.|.:|.:::..:..|:.|:              ||.....:.|:.  |.....:..|.::...
Human   420 VYPCMICGKKFKSRGFLKRHM--------------KNHPEHLAKKKYHCTDCDYTTNKKISLHNH 470

  Fly    71 SENSEPPASELQPMPFKDFRLVLRANMLEPCSFGKECPFKFQDATKMELHCSCH--KGGS--FSC 131
            .|:               .:|..:|.....|.   ||...|..|..:..|...|  ||.:  ..|
Human   471 LES---------------HKLTSKAEKAIECD---ECGKHFSHAGALFTHKMVHKEKGANKMHKC 517

  Fly   132 CECGMELPNWRRCSAHLWKAHQVDVDLLVCPVFEC--NYKSPISALVWRHMQVHKKWRPR----- 189
            ..|..|.......:.||...|..:.. .:|  .||  .::.|  :.:.:||::|...:|.     
Human   518 KFCEYETAEQGLLNRHLLAVHSKNFP-HIC--VECGKGFRHP--SELRKHMRIHTGEKPYQCQYC 577

  Fly   190 VLRSLAAVQRRRKLK-EQSAEM----------------AAQPAALPPSSKKNKYYAEKTCEICNR 237
            ..||..:...:..:| :.|.||                ..|...:...||.::      |..|:.
Human   578 EYRSADSSNLKTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQ------CLHCDH 636

  Fly   238 KFVNGKTLSKHVKTVHNKIKPFICNVCGKKTARKASLIIHMRQHTGEKPLQCGECKFSTRDPSVL 302
            |..|...|.:||.:||.|..|..|.:|.|...|.:.|..|:..|.|:|..||..|.|...||.||
Human   637 KSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFVL 701

  Fly   303 HKHRQRHDSQDTRSSLKCSQCDYFCIQANALKRHMRLNHA-EAYRDLCCDICSFTSINVERLRAH 366
            .:|.....::|.  ..:|.:|.....|.|.||:||:.:.. :.|:   |:.|.:::.:....:.|
Human   702 SRHILSVHTKDL--PFRCKRCRKGFRQQNELKKHMKTHSGRKVYQ---CEYCEYSTTDASGFKRH 761

  Fly   367 K-QDHRQGLITNCEDSMDARAAGFKYPRKVGDKNGEI 402
            . ..|.:.....||..    ..||:.|   .:||..|
Human   762 VISIHTKDYPHRCEYC----KKGFRRP---SEKNQHI 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 7/20 (35%)
C2H2 Zn finger 261..281 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..309 CDD:275368 8/19 (42%)
ZFYNP_001356631.1 Zfx_Zfy_act 71..406 CDD:309717
COG5048 <417..592 CDD:227381 39/208 (19%)
C2H2 Zn finger 423..443 CDD:275368 5/33 (15%)
C2H2 Zn finger 454..478 CDD:275368 4/38 (11%)
C2H2 Zn finger 486..506 CDD:275368 6/22 (27%)
COG5048 539..>676 CDD:227381 33/147 (22%)
C2H2 Zn finger 546..566 CDD:275368 6/23 (26%)
zf-H2C2_2 558..582 CDD:338759 5/23 (22%)
C2H2 Zn finger 574..593 CDD:275368 2/18 (11%)
C2H2 Zn finger 603..652 CDD:275368 10/54 (19%)
C2H2 Zn finger 660..680 CDD:275368 6/19 (32%)
zf-C2H2 715..737 CDD:333835 8/21 (38%)
C2H2 Zn finger 717..737 CDD:275368 8/19 (42%)
zf-H2C2_2 729..753 CDD:338759 7/26 (27%)
C2H2 Zn finger 745..766 CDD:275368 3/20 (15%)
C2H2 Zn finger 774..794 CDD:275368 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.