DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and Lime

DIOPT Version :9

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster


Alignment Length:396 Identity:67/396 - (16%)
Similarity:117/396 - (29%) Gaps:154/396 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSLCLRQYDLQEDLRGHLVYFHGYE---------------PISTPSVK--NKTAKTSTKEQTAAG 58
            |.||.:.::..|..:.||.. |..|               |..||.|:  ||.....|.:.....
  Fly    81 CYLCKQPFNDIESFKEHLTQ-HAAEINAWNNTRAQEQTPPPTITPFVQSMNKPFVHPTDQHLFHS 144

  Fly    59 SNSQDKQTVVERSENSE---------PPASELQPMPFKDFRLVLRANMLEPCSFGKECPFKFQDA 114
            .:..|    ::...|:.         ||..:....|            |||     |.||     
  Fly   145 IDHGD----MDHHHNAHYRNRMEFGCPPPMDFYSPP------------LEP-----EIPF----- 183

  Fly   115 TKMELHCSCHKGGSFSCCECGMELPNWRRCSAHLWKAHQVDVDLLVCPVFECNYKSPISALVWRH 179
                                  ::|     :.|   .|.:.:..:........|:.|:..|..|.
  Fly   184 ----------------------QMP-----AVH---QHPIQIPPMYMTAQHTAYEPPVQFLGHRP 218

  Fly   180 MQVHKKWRPRVLRSLAAVQRRRKLKEQSAEMAAQPAALPPSS--KKNKYYAEKTCEICNRKFV-- 240
            :::                 |:|| ..|.:...:|:..|.:|  ..|::.:.:...:|..:.:  
  Fly   219 LEL-----------------RQKL-PMSPQSPLEPSGHPMASAIPSNQHTSLEMQNLCVPEGILT 265

  Fly   241 -----------------------NGKTLS--------KHVKTVHNKIKPFICNVCGKKTARKASL 274
                                   .||:.|        .:.|::......|.||.|||:.:.:.||
  Fly   266 RVEEPPVLENPRPQAQDPIQDAGAGKSRSAVLIEPKPPNAKSLAFNQGQFECNWCGKRLSSRQSL 330

  Fly   275 IIHMRQHTGEKPLQCGECKFSTRDPSVLHKHRQRHDSQDTRSSLKCSQCDYFCIQANALKRHMRL 339
            ..|.....|.|     |...:..:.::..:|             ||..|.....:...|..||::
  Fly   331 KYHESHFHGNK-----ELAVNRLEKNLTKQH-------------KCLTCKKRYKRRTFLLMHMKV 377

  Fly   340 NHAEAY 345
            .|..|:
  Fly   378 KHGIAF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 5/53 (9%)
C2H2 Zn finger 261..281 CDD:275368 8/19 (42%)
C2H2 Zn finger 289..309 CDD:275368 2/19 (11%)
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 8/18 (44%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.