DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:165 Identity:45/165 - (27%)
Similarity:68/165 - (41%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SAEMAAQPAALPPSSK-----KNKYYAEKTCEICNRKFVNGKTLSKHVKTVHNKIKPFICNVCGK 266
            |::::..|..  ||.|     |.:|    .||.|:..|...:.|:.|:: :|:..:|..|..|||
 Worm    66 SSQLSMNPTT--PSEKSSSGEKGRY----ECEDCHEMFAVKRELATHMR-IHSGEQPHSCTQCGK 123

  Fly   267 KTARKASLIIHMRQHTGEKPLQCGECKFSTRDPSVLHKHRQRHDSQDTRSSLKCSQCDYFCIQAN 331
            :...:..|..|...||||:...|..|..:......|.:|...|......   :|.||....|...
 Worm   124 EFGTRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPH---ECPQCHKTFIFKF 185

  Fly   332 ALKRHMRLNHAEAYRDLCCDICSFTSINVERLRAH 366
            .|.|||:: |.|  |...|..|..:.:....|..|
 Worm   186 DLNRHMKI-HQE--RGFSCQQCGRSFLKQVMLDEH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 6/20 (30%)
C2H2 Zn finger 261..281 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 6/20 (30%)
zf-H2C2_2 102..127 CDD:290200 8/25 (32%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 4/19 (21%)
zf-H2C2_2 158..181 CDD:290200 6/25 (24%)
zf-C2H2 172..194 CDD:278523 8/25 (32%)
C2H2 Zn finger 174..194 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.