DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and F58G1.2

DIOPT Version :9

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001254358.1 Gene:F58G1.2 / 174931 WormBaseID:WBGene00010264 Length:500 Species:Caenorhabditis elegans


Alignment Length:395 Identity:79/395 - (20%)
Similarity:126/395 - (31%) Gaps:129/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENSAR-IVYVCSLCLRQYDLQEDLRGHLVYFHGYEPISTPSVKNKTAKTSTKEQTAAGSNSQDK 64
            :.|:.| .::.|.:|..::.....|..||...|       |.......:...:.....|...:::
 Worm   158 IRNAVRKSMFRCKVCKNRFGEMSLLERHLRDSH-------PKAYIAFLENQREMADYMGELERER 215

  Fly    65 QTVVER-SENSEPPASELQ-----------PMPFKDF-----RLVLRANMLEPCSF--------- 103
            ..:.|. |....||.||::           |:|.::.     ||.....::.|...         
 Worm   216 NRIEELVSGGFIPPESEIEATSNNLEVDSIPLPGENSQGHIPRLNRYGGLMYPMDALRKKFPYLK 280

  Fly   104 --GKECPF---KFQD-------ATKME---------LHCSCHKGGSFSCCECGMELPNWRRCSAH 147
              ..:|||   :|::       .||..         |||       |.|.....:||        
 Worm   281 KRSPQCPFCDKRFRNDISFNNHLTKKHPECAEFVQCLHC-------FKCLPSAADLP-------- 330

  Fly   148 LWKAHQVDVDLLVCPVFECNYKSPISAL-----VWRHMQVHKKWRPRVLRSLAAVQRRRKLKEQS 207
               .|..|:..| |  .:|.   ||..:     ::||       |.:..|.              
 Worm   331 ---THDCDLTYL-C--LDCR---PIRNMCNGYRLFRH-------RTKFHRG-------------- 365

  Fly   208 AEMAAQPAALPPSSKKNKYYAEKTCEICNRKFVNGKTLSKHVKTVHNKIKPFICNVCGKKTARKA 272
                              |::...|..||:||:..:.|.||.|..|...:.|.|:.|.:......
 Worm   366 ------------------YHSGFRCPDCNQKFLTPRKLRKHRKMAHVFSRTFQCHFCEEFFISDT 412

  Fly   273 SLIIHMRQHTGEKPLQCGECKFSTRDPSVLHKHRQRHDSQDTRSSLKCSQCDYFCIQANALKRHM 337
            ::.||.|.|||....:|..|.|.......:.:|.:.|      ....||.|...|...|.:|.||
 Worm   413 AVTIHERVHTGILKFECTVCDFRASRYLQMEEHTKEH------HGYMCSVCQLKCQHWNDIKDHM 471

  Fly   338 RLNHA 342
            ...|:
 Worm   472 LAEHS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 9/20 (45%)
C2H2 Zn finger 261..281 CDD:275368 5/19 (26%)
C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
F58G1.2NP_001254358.1 bZIP <186..222 CDD:304365 5/42 (12%)
C2H2 Zn finger 372..393 CDD:275368 9/20 (45%)
C2H2 Zn finger 401..421 CDD:275368 5/19 (26%)
C2H2 Zn finger 429..449 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.