DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11456 and si:ch211-202h22.10

DIOPT Version :9

Sequence 1:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_017212100.2 Gene:si:ch211-202h22.10 / 100002322 ZFINID:ZDB-GENE-110914-121 Length:519 Species:Danio rerio


Alignment Length:408 Identity:104/408 - (25%)
Similarity:165/408 - (40%) Gaps:59/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YVCSLCLRQYDLQEDLRGHLVYFHGYEPISTPSV-KNKTAKTSTKEQTAAGSNSQDKQTVVERSE 72
            :.|:.|.::|.:::.|..|:....|.:|.:.|.. |..|||...|...:.  :.::|        
Zfish   122 FSCTQCGKRYKVKQSLESHMRVHTGEKPFACPQCGKGFTAKQCLKSHMSV--HIEEK-------- 176

  Fly    73 NSEPPASELQPMPFKDFRLVLRANML----EPCSFGKECPFKFQDATKMELHCSCHKGGS-FSCC 132
               |....|..|.| ..:..|:.:||    |.....::|...|.....:|.|...|.|.. |:|.
Zfish   177 ---PFNCSLCEMSF-THQQSLKRHMLIHVGEKPYVCRQCGKSFSVKQSLESHIRIHTGEKPFACA 237

  Fly   133 ECGMELPNWRRCSAHLWKAHQVDVDLLVCPVFECNYKSPISALVWRHMQVHKKWRP---RVLRSL 194
            |||......:...:|: :.| ..|....||  :|..:..:...:..||.:|...||   .:....
Zfish   238 ECGKGFAVKQNLESHM-RVH-TGVKPFSCP--QCGKRFTVKQSLESHMTIHTGERPFTCSMCDKT 298

  Fly   195 AAVQRRRK--LKEQSAEMAAQPAALPPSSKKNKY-------------YAEK--TCEICNRKFVNG 242
            ..|:.:.:  ::..:.|   :|...|...  |.|             ..||  :|..|.::|...
Zfish   299 FTVKHKLEYHMRNHTGE---KPYICPQCG--NSYALRNHLERHVRIHTGEKPFSCSKCAKRFTMK 358

  Fly   243 KTLSKHVKTVHNKIKPFICNVCGKKTARKASLIIHMRQHTGEKPLQCGECKFSTRDPSVLHKHRQ 307
            ::|..|:: |||:.||:||:.|||:...|.||..||..||||||..|.||..|......|..|.:
Zfish   359 QSLKSHMR-VHNRTKPYICSQCGKRFTVKQSLESHMSLHTGEKPFTCTECGKSYTLRQSLETHMR 422

  Fly   308 RHDSQDTRSSLKCSQCD-YFCIQANALKRHMRLNHAEAYRDLCCDICSFTSINVERLRAHKQDHR 371
            .|...   ....||.|. .|.::.| |..|||::..|  |...|..|........:|..|.:.|.
Zfish   423 VHTGD---KCFSCSDCGRSFTVKQN-LHVHMRVHTGE--RPYTCAQCGKRFTQHGQLNRHMRIHT 481

  Fly   372 QGLIT--NCEDSMDARAA 387
            :...|  ..|::::...|
Zfish   482 EQKTTRDRSEETLNDETA 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 5/20 (25%)
C2H2 Zn finger 261..281 CDD:275368 9/19 (47%)
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
si:ch211-202h22.10XP_017212100.2 C2H2 Zn finger 12..32 CDD:275368
COG5048 36..439 CDD:227381 88/343 (26%)
C2H2 Zn finger 40..60 CDD:275368
C2H2 Zn finger 68..88 CDD:275368
C2H2 Zn finger 96..116 CDD:275368
C2H2 Zn finger 124..144 CDD:275368 5/19 (26%)
C2H2 Zn finger 152..172 CDD:275368 6/21 (29%)
C2H2 Zn finger 180..200 CDD:275368 6/20 (30%)
C2H2 Zn finger 208..228 CDD:275368 4/19 (21%)
C2H2 Zn finger 236..256 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..284 CDD:275368 5/21 (24%)
C2H2 Zn finger 292..312 CDD:275368 1/19 (5%)
C2H2 Zn finger 320..340 CDD:275368 3/21 (14%)
C2H2 Zn finger 348..368 CDD:275368 5/20 (25%)
C2H2 Zn finger 376..396 CDD:275368 9/19 (47%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..452 CDD:275368 9/20 (45%)
zf-H2C2_2 448..469 CDD:316026 7/22 (32%)
C2H2 Zn finger 460..480 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.