DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN3 and RPN3

DIOPT Version :9

Sequence 1:NP_524190.2 Gene:CSN3 / 40308 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_010938.1 Gene:RPN3 / 856742 SGDID:S000000823 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:429 Identity:84/429 - (19%)
Similarity:148/429 - (34%) Gaps:117/429 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SLSLL-ARNWSILDNVLETL---------DMQQHSLGVLYVLLAKLHSASTANPEPVQLIQL-MR 84
            ||:|: |:.|..:....|||         |.|...|....:...|:.|....|.....||.| :|
Yeast   175 SLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILR 239

  Fly    85 DFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSILGIRIISRAIDQIRQLETQLTPIHADLCL 149
            ||:  ||.|                                :..|.|.|.:||...|.:.:    
Yeast   240 DFL--NNGE--------------------------------VDSASDFISKLEYPHTDVSS---- 266

  Fly   150 LSLKAKNFSVVLPYLDADITDISTVAAECKTQQQQQSQHADANNDAKYFLLYFYYGGMIYTAVKN 214
             ||:|:                                             ||:|...|.....:
Yeast   267 -SLEAR---------------------------------------------YFFYLSKINAIQLD 285

  Fly   215 YERA-LYFFEVCITTPAMAMSHIMLEAYKKFLMVSLIVEGKIAYIPKNTQVIGRFMKPMANHYHD 278
            |..| .|........|..:.|...|:...|......::.|.|..:....|  ....|.:..:|| 
Yeast   286 YSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQ--SNMQKSLLPYYH- 347

  Fly   279 LVNVYANSSSEELRIIILKYSEAFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQ 343
            |.........::....|.||.:...:|:...|..::.:::.|..|:.::.|:..:||.|:..::.
Yeast   348 LTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLN 412

  Fly   344 LASAVEAERYILNMIKSGEIYASINQKDGMVLFKDDPEKYNS--PEMFLNVQNNITHVLDQVRQI 406
            |.|....|..:...|:.|.|.|.||.:||.:...:....|:|  |:...:         ::::..
Yeast   413 LDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFD---------ERIKFA 468

  Fly   407 NKMEEEIILNPMYVKKALGSQDDDLTSQHPKTFSGDPTD 445
            |::.:|.:::..|       .:|..|.|:.|:.:|:..|
Yeast   469 NQLHDEYLVSMRY-------PEDKKTQQNEKSENGENDD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 25/102 (25%)
RPN3NP_010938.1 PCI 343..447 CDD:396121 25/104 (24%)
Rpn3_C 450..509 CDD:400604 12/67 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.