DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN3 and Rpn3

DIOPT Version :9

Sequence 1:NP_524190.2 Gene:CSN3 / 40308 FlyBaseID:FBgn0027055 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001260557.1 Gene:Rpn3 / 35176 FlyBaseID:FBgn0261396 Length:494 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:143/381 - (37%) Gaps:51/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VLLAKLHSASTANPEPVQLIQLMRDF-VQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSILGIR 124
            :||.||..||......:....||... :|......|..|...||     |:.....|| |:.|||
  Fly   131 LLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFY-----FSRVAELKN-SLEGIR 189

  Fly   125 IISRAIDQIR------QLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKTQQQ 183
            ....|  ::|      ..|.|...|:   |||    :|:.....|..||           |..::
  Fly   190 SFLHA--RLRTATLRNDFEGQAVLIN---CLL----RNYLHYALYDQAD-----------KLVKK 234

  Fly   184 QQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERA-LYFFEVCITTPAMAMSHIMLEAYKKFLMV 247
            .....:.:||:...||   ||.|.|..|...|..| .:..:....:|..|.........|..::|
  Fly   235 SVYPESASNNEWARFL---YYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVV 296

  Fly   248 SLIVEGKIAYIPKNTQVIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYSEAFTRDNNMGLAK 312
            .|:    :..||:........::.....|..|.......:.:....::.:|...|..|:...|..
  Fly   297 ELL----LGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLII 357

  Fly   313 QVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIKSGEIYASINQKDGMVLFK 377
            ::..::.|..|:.:..::..:|..|:|.|:.|.||.:||..:...|:.|.|.|:::.....:..|
  Fly   358 RLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAEDAEFIVSKAIRDGVIEATLDPAQNFMRSK 422

  Fly   378 DDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMYVKKALGSQDDDLTS 433
            :..:.|::.|..|.....|:..|:       :..:.:....|..|:.|.   ||.|
  Fly   423 ESTDIYSTREPQLAFHERISFCLN-------LHNQSVKAMRYPPKSYGK---DLES 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN3NP_524190.2 PCI 275..378 CDD:279707 21/102 (21%)
Rpn3NP_001260557.1 PCI 320..413 CDD:279707 21/92 (23%)
Rpn3_C 426..484 CDD:285563 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10758
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.