DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-R1 and Cnbd2

DIOPT Version :9

Sequence 1:NP_001189150.1 Gene:Pka-R1 / 40305 FlyBaseID:FBgn0259243 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_081861.2 Gene:Cnbd2 / 70873 MGIID:1918123 Length:673 Species:Mus musculus


Alignment Length:153 Identity:39/153 - (25%)
Similarity:71/153 - (46%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 IIQQGDEGDNFYVIDVGEVDV---------FVNSELVTTISEGGSFGELALIYGTPRAATVRAKT 301
            |:::|..|::||.|.:|.|.:         |::.. .|.:..||||||:.|:..|.|:|||....
Mouse   233 IVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPH-PTLLHRGGSFGEMGLLSTTVRSATVVCME 296

  Fly   302 DVKLWGIDRDSYRRILMGSTIRKRKMYE-EFLSRVSILESL--DKWERLTVADSLETCSFDDGET 363
            :.:...:||:.:....:|..::|...|. .|...:.|.:|.  :|..:|.....:|..|:  |:.
Mouse   297 ETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKLWKLVALGRIERFSY--GQM 359

  Fly   364 IVKQGAAGDDFYIILEGCAVVLQ 386
            :.|..........|.:|...:|:
Mouse   360 VSKDFMNSAFITFICQGNCEILR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-R1NP_001189150.1 Crp 213..>339 CDD:223736 29/102 (28%)
CAP_ED 219..328 CDD:237999 26/90 (29%)
Crp 331..>442 CDD:223736 12/58 (21%)
CAP_ED 337..453 CDD:237999 11/52 (21%)
Cnbd2NP_081861.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89
Crp 200..>353 CDD:223736 32/120 (27%)
CAP_ED 211..308 CDD:237999 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.