DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-R1 and CG12698

DIOPT Version :9

Sequence 1:NP_001189150.1 Gene:Pka-R1 / 40305 FlyBaseID:FBgn0259243 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_573100.1 Gene:CG12698 / 32570 FlyBaseID:FBgn0030721 Length:580 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:90/216 - (41%) Gaps:37/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 TNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDI-----FDAMFPVNHIAGENIIQQGDE 252
            |.:.|:.|.:..|    |...:|....|:......|:.:     |.|:.|     |..::::.|.
  Fly    74 TPHAKRSVDERKK----LCTIVANLACFSKFPPKVRARLVPIVKFMAISP-----GRIVMKEEDF 129

  Fly   253 GDNFYVIDVGEVDVFVN-----SELVTTISE-----GGSFGELALIYGTPRAATVRAKTDVKLWG 307
            ....|.|..|||::..|     |...|..:|     |...|::.::..|||..|..|.|..:|..
  Fly   130 PVTIYFIIAGEVEMSKNIYKKGSSRPTVQTEAIFGPGDCIGDIDVMEDTPRTNTYIATTYCELLA 194

  Fly   308 IDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW-----ERLTVADSLETC-SFDDGETIVK 366
            |...:|:.:|:..   .:||::|   :...|.:||.:     |::..|....|. .|:..|||..
  Fly   195 IFNTNYKIVLLPF---MQKMWQE---KKDALRALDYFDFLNEEQIVNASKYGTIQQFEPLETIYT 253

  Fly   367 QGAAGDDF-YIILEGCAVVLQ 386
            :......: |.:|.|..||||
  Fly   254 EDLGTMSYVYFVLSGECVVLQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-R1NP_001189150.1 Crp 213..>339 CDD:223736 32/140 (23%)
CAP_ED 219..328 CDD:237999 29/123 (24%)
Crp 331..>442 CDD:223736 17/63 (27%)
CAP_ED 337..453 CDD:237999 17/57 (30%)
CG12698NP_573100.1 Crp 97..>195 CDD:223736 25/102 (25%)
CAP_ED 97..195 CDD:237999 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.