DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-R1 and CNBD2

DIOPT Version :9

Sequence 1:NP_001189150.1 Gene:Pka-R1 / 40305 FlyBaseID:FBgn0259243 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_011526892.1 Gene:CNBD2 / 140894 HGNCID:16145 Length:617 Species:Homo sapiens


Alignment Length:153 Identity:33/153 - (21%)
Similarity:71/153 - (46%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 IIQQGDEGDNFYVIDVGEVDVFVNSELVTT--------ISEGGSFGELALIYGTPRAATVRAKTD 302
            ||::|.:|::||.|.:|.|.:..:.:..:.        :.:|..|||:.:::.:.|.:|:....:
Human   184 IIKKGQKGNSFYFIYLGTVAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEE 248

  Fly   303 VKLWGIDRDSYRRILMGSTIRKRKMYE-EFLSRVSILESLDK---WERLTVADSLETCSFDDGET 363
            .:...:||:.:....:...::|...|. ||..::.:..|...   |:.:.:| .:|..|:  |:.
Human   249 TEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWSDEKLWQLVAMA-KIERFSY--GQL 310

  Fly   364 IVKQGAAGDDFYIILEGCAVVLQ 386
            |.|..........|.:|...||:
Human   311 ISKDFGESPFIMFISKGSCEVLR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-R1NP_001189150.1 Crp 213..>339 CDD:223736 21/101 (21%)
CAP_ED 219..328 CDD:237999 18/89 (20%)
Crp 331..>442 CDD:223736 13/59 (22%)
CAP_ED 337..453 CDD:237999 12/53 (23%)
CNBD2XP_011526892.1 Crp 151..>282 CDD:223736 21/97 (22%)
CAP_ED 163..259 CDD:237999 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.