DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3618 and FAM234A

DIOPT Version :9

Sequence 1:NP_001189143.1 Gene:CG3618 / 40303 FlyBaseID:FBgn0037028 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001271426.1 Gene:FAM234A / 83986 HGNCID:14163 Length:552 Species:Homo sapiens


Alignment Length:313 Identity:68/313 - (21%)
Similarity:121/313 - (38%) Gaps:82/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DNGGVGSELSHFNSDFDANADNVAILGDHNQTGEDLSKRTPMSPARKC---CFIGSLLLCFLA-- 181
            |:..:.:|:....::...:.:|   ||:.::..:::....|.|...:|   .|..||.||...  
Human     3 DHKDLEAEIHPLKNEERKSQEN---LGNPSKNEDNVKSAPPQSRLSRCRAAAFFLSLFLCLFVVF 64

  Fly   182 VVSFVWLVPCGNPDGTGSCPAVGDRIKTHNWFNNYTKAELKG--GINVVGGLRAWENNLIFMYRG 244
            |||||  :||  ||...|         ...|..:|:.|.:..  .::.:.|.|.  .:::|:|:.
Human    65 VVSFV--IPC--PDRPAS---------QRMWRIDYSAAVIYDFLAVDDINGDRI--QDVLFLYKN 114

  Fly   245 DAFFPEFRPGNERRNGI-----------ICLIGSSGAVAWFVEMVDEPVALDCTLIDI-----DG 293
            ..     ...|..|:.:           ..:.|::|:..|     :.|||.|..|::.     .|
Human   115 TN-----SSNNFSRSCVDEGFSSPCTFAAAVSGANGSTLW-----ERPVAQDVALVECAVPQPRG 169

  Fly   294 NGKP-ACLVLDEYGELGAIHPVSGEWIWWHKERSARKVDAYDFPVILPDLDADGVLDLLLVTSLS 357
            :..| ||:::.......|::..:||.:|.|....:.........:.:||:|.||..|||::|.  
Human   170 SEAPSACILVGRPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVLTQ-- 232

  Fly   358 LVQRTKSLAQLKHESPEKLEARNVLRMLSGRRGAPIG----------DGFTIH 400
                            |:.|...  .:.||..|..||          .||.:|
Human   233 ----------------EREEVSG--HLYSGSTGHQIGLRGSLGVDGESGFLLH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3618NP_001189143.1 None
FAM234ANP_001271426.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 5/39 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.