DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and AT3G60510

DIOPT Version :10

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001190144.1 Gene:AT3G60510 / 825222 AraportID:AT3G60510 Length:426 Species:Arabidopsis thaliana


Alignment Length:199 Identity:45/199 - (22%)
Similarity:75/199 - (37%) Gaps:41/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 VLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALKCYLRTLATFPKPLVAGIVGSQINLGV 783
            |::...|..||.|.|...|.........|:..:...:|..::..|.|:.||.||.:.|..:..|.
plant    85 VMMKGSGRAFCAGGDIVSLYHLRTRGSPDAIREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGT 149

  Fly   784 -MQLPFADYVVASDDCSFETNYAKLGQLPEGYALWHGHQRVSSEVHSRLFLMGERLFATELLESN 847
             :.:| ..:.||:|...|.|....:|..|:..|.::     .|.:..||   ||.|..|.|    
plant   150 GVSIP-GTFRVATDRTIFATPETIIGFHPDAGASFN-----LSHLPGRL---GEYLGLTGL---- 201

  Fly   848 SFVDKICKARNVNEMALAKAKQISTSSAEMYRTLKKLNHSAVNVTKFPRLDEELK--VIGEQWVT 910
                           .|:.|:.::...|..|          :...:.|.::|:||  :..:..|.
plant   202 ---------------KLSGAEMLACGLATHY----------IRSEEVPVMEEQLKKLLTDDPSVV 241

  Fly   911 ADCL 914
            ..||
plant   242 ESCL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 PTZ00449 <148..580 CDD:185628
crotonase-like 673..870 CDD:119339 36/151 (24%)
AT3G60510NP_001190144.1 PLN02157 1..426 CDD:177817 45/199 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.