DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIPP1 and AT2G30650

DIOPT Version :10

Sequence 1:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_180623.3 Gene:AT2G30650 / 817615 AraportID:AT2G30650 Length:378 Species:Arabidopsis thaliana


Alignment Length:197 Identity:42/197 - (21%)
Similarity:77/197 - (39%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 VLLTVEGPQFCQGID----CQELIQGSLEKRKDSASQLAVALKC-YLRTLATFPKPLVAGIVGSQ 778
            |:|..:|..|..|.|    .::::||.|.:   .|....|.... |:  |:|:.||.|:.:.|..
plant    53 VVLKGQGRAFSAGGDIPPIVRDILQGKLIR---GAHYFKVGYTLNYV--LSTYRKPQVSILNGIV 112

  Fly   779 INLGVMQLPFADYVVASDDCSFETNYAKLGQLPE---GYALWHGHQRVSSEVHSRLFLMGERLFA 840
            :..|........:.:|:::..|......||..|:   .|.|    .|:.......:.|.|.||..
plant   113 MGGGAGLSTNGRFRIATENTVFAMPETALGLFPDVGASYFL----SRLPGFFGEYVGLTGARLDG 173

  Fly   841 TELLE---SNSFVDKICKARNVNEMALAKAKQISTSSAEMYRTLKKLNHSAVNV-----TKFPRL 897
            .|:|.   :..||..|               .::...||:|: :...|.:.::.     .::|.|
plant   174 AEMLACGLATHFVPSI---------------SLTALEAELYK-VGSSNQTFISTILDAYAEYPHL 222

  Fly   898 DE 899
            ::
plant   223 NQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPP1NP_649261.1 PTZ00449 <148..580 CDD:185628
crotonase-like 673..870 CDD:119339 36/161 (22%)
AT2G30650NP_180623.3 crotonase-like 1..375 CDD:474030 42/197 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.