DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psma5 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_991271.1 Gene:psma5 / 403011 ZFINID:ZDB-GENE-040625-96 Length:241 Species:Danio rerio
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:237 Identity:81/237 - (34%)
Similarity:136/237 - (57%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


Zfish     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI 70
            |.|.|.:..|||:|.|.|||||.||::.||||:|::.:..|.|.|||...|.:.|..::.||..:
  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67

Zfish    71 DSHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSR 135
            |.|:..|.:||.|||:.||::.:||.|:|...:...:|:|.:|:.::.|..::.:.:.     .|
  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNG-----RR 127

Zfish   136 PFGVALLFGGVDEKG-PQLYHMDPSGTFVQCDARAIGSASEGAQSSLQEVY--HKSMTLKDAIKS 197
            |||::.|.||:|..| .:|:|.:|||.|.:..|.|.|..:...:...::.|  |:..|..||||.
  Fly   128 PFGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKL 192

Zfish   198 SLTILKQVMEEKLNATNIELATVEPGKTFHMYTKEELEDVIK 239
            ::..|.:|.:  ::...:|:|.:|.||...|.....:.:::|
  Fly   193 AMRALLEVTQ--MSQMRLEVAVLENGKPMKMLDSVVISEIVK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psma5NP_991271.1 proteasome_alpha_type_5 8..220 CDD:239722 75/214 (35%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 80/235 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 75/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.