DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eif4h and eIF4B

DIOPT Version :9

Sequence 1:NP_001184257.1 Gene:eif4h / 402996 ZFINID:ZDB-GENE-010328-19 Length:262 Species:Danio rerio
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:300 Identity:80/300 - (26%)
Similarity:123/300 - (41%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish     3 DYDNYDDRDRAYGSFGGGRGPRGGGGPSGPRKQK-----ELPTEPPYTAYVGNLPFNTVQGDIDA 62
            |.|:.||        |.|..|.....|:.||..:     .:|.:.|:.||:.||||:..:.|:..
  Fly    42 DGDDSDD--------GSGTLPLVYQLPTAPRANRIFDDNSIPHKAPFIAYINNLPFDANEDDLYE 98

Zfish    63 IFRDLSVRSVRLVR-DKETDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIAEGRRQE-- 124
            .|..:::.|:||.| |.|..:.:||.|||.::.|.|...|:.....:..|.:|::::....|:  
  Fly    99 FFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSR 163

Zfish   125 ----RGGGGFGFRKDDRGRGGSRGARGGGRDSREDFDQSGGGAAGEMGF---------RDDDFMG 176
                |...|||...|:|..|..|      |||:.:....|..:..|..|         |||....
  Fly   164 QKSNRRFDGFGNNGDNRDSGNWR------RDSQNNGSNFGYSSNFERSFNRERKSLPDRDDVNTP 222

Zfish   177 GRSRGGGRPGD------RRGGAGGGGGGGGGMGRFRDGPPRGGQTDFREPSDEERAQRPRLQLKP 235
            |..|...||..      ||......       .::|:|..:......||.:.:...:||:|.|||
  Fly   223 GSWRTSARPQSIDTSPTRREVEQVS-------EKYREGRVKIADRYSREETSKVEEERPKLNLKP 280

Zfish   236 RTVAGP----------------LNQVANPNSA-IFGGAKP 258
            ||:..|                |::....:|. :||.|||
  Fly   281 RTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eif4hNP_001184257.1 RRM <39..>118 CDD:223796 26/79 (33%)
RRM_eIF4H 43..118 CDD:240847 25/75 (33%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 54/208 (26%)
RRM_eIF4B 79..155 CDD:240848 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.