DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and GLY3

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_564636.2 Gene:GLY3 / 841793 AraportID:AT1G53580 Length:294 Species:Arabidopsis thaliana


Alignment Length:270 Identity:67/270 - (24%)
Similarity:108/270 - (40%) Gaps:98/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YMYLIVDTK--TREAAVVDPVEP--ELVIKTVQEQQLTLSKVLTTHHHWDHAGG----------- 151
            :.||:.|..  .:.|.::|||:.  :..:|.:.|..|.|...:.||.|.||..|           
plant    65 FTYLLADVSHPDKPALLIDPVDKTVDRDLKLIDELGLKLIYAMNTHVHADHVTGTGLLKTKLPGV 129

  Fly   152 NEKLLKLWEKELDVYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSG 216
            ...:.|....:.|::            ::..|..:||.::::..:||.||.|.:.| :|     |
plant   130 KSVISKASGSKADLF------------LEPGDKVSIGDIYLEVRATPGHTAGCVTY-VT-----G 176

  Fly   217 EGA-------VFTGDTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSF 272
            |||       .||||.:...||||  |.||:.:::||::.:::..||..|.::..|:|    ..|
plant   177 EGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHSQIFTLPKDTLIYPAHDY----KGF 237

  Fly   273 ARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKHAGGATDPVVTMG 337
                    ||                    ||:|||...||                        
plant   238 --------EV--------------------STVGEEMQHNP------------------------ 250

  Fly   338 KLRKEKDTFK 347
            :|.|:|:|||
plant   251 RLTKDKETFK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 65/268 (24%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 49/184 (27%)
HAGH_C 264..344 CDD:292741 13/79 (16%)
GLY3NP_564636.2 PLN02962 51..292 CDD:178547 67/270 (25%)
POD-like_MBL-fold 53..234 CDD:293810 50/186 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.