DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and si:ch73-71c20.5

DIOPT Version :10

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001313494.1 Gene:si:ch73-71c20.5 / 566338 ZFINID:ZDB-GENE-060810-58 Length:168 Species:Danio rerio


Alignment Length:65 Identity:17/65 - (26%)
Similarity:31/65 - (47%) Gaps:12/65 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GHEYTLQN---------MSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEEKSWNPFMRV 317
            || :|||.         |:..:..||:|:..||:.|  :.....::...|..:.:.|:.||.|::
Zfish    51 GH-HTLQTITKTEPPRVMNTQKSAEPENKTNQQKKE--EEEEEEEEDNRPEYMPKGKAKNPMMKI 112

  Fly   318  317
            Zfish   113  112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 17/65 (26%)
si:ch73-71c20.5NP_001313494.1 DUF4748 108..158 CDD:435027 2/5 (40%)

Return to query results.
Submit another query.