DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and mblac2

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001116739.1 Gene:mblac2 / 563823 ZFINID:ZDB-GENE-081104-313 Length:275 Species:Danio rerio


Alignment Length:225 Identity:48/225 - (21%)
Similarity:79/225 - (35%) Gaps:64/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RGMHSTLEDVQLE-GMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKV 139
            ||.|   :||.:: |:.::.||........|..|.|.:        .|.|.|             
Zfish    36 RGSH---QDVVIDTGLGLRSLPEYIQEKSLLGDDAKRK--------NPLLAI------------- 76

  Fly   140 LTTHHHWDHAGGNEKL--LKLWEKELDVYGGDD--------------------------RIGALN 176
             .||.|:||:||..:.  :.:.:.|:|.....|                          |:.|:.
Zfish    77 -GTHVHFDHSGGLHQFQQVGVHKAEVDALANGDNFETVTWLSDREIVEVPSPGWRARQYRVKAVT 140

  Fly   177 KK--VQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTP 239
            ..  :|:.|...:|...:..|..|.|:.|.||.|....:     .:|:||.::.|....:...:.
Zfish   141 PTHILQEGDVINLGDRQLSVLHMPGHSRGSICLHDKESK-----MLFSGDVVYDGSMIDWLPYSR 200

  Fly   240 EEMYEALCTKLSALPD---ATKVFCGHEYT 266
            ...|...|.:|..:.|   ..:|..||..|
Zfish   201 ISDYIHSCERLVEMVDKEEIDQVMPGHYNT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 42/210 (20%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 39/202 (19%)
HAGH_C 264..344 CDD:292741 1/3 (33%)
mblac2NP_001116739.1 GloB 15..240 CDD:223565 48/225 (21%)
MBLAC2-like_MBL-fold 22..227 CDD:293798 45/220 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593963
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.