Sequence 1: | NP_730568.1 | Gene: | tzn / 40299 | FlyBaseID: | FBgn0037024 | Length: | 348 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116739.1 | Gene: | mblac2 / 563823 | ZFINID: | ZDB-GENE-081104-313 | Length: | 275 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 48/225 - (21%) |
---|---|---|---|
Similarity: | 79/225 - (35%) | Gaps: | 64/225 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 RGMHSTLEDVQLE-GMEIKILPALQDNYMYLIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKV 139
Fly 140 LTTHHHWDHAGGNEKL--LKLWEKELDVYGGDD--------------------------RIGALN 176
Fly 177 KK--VQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTP 239
Fly 240 EEMYEALCTKLSALPD---ATKVFCGHEYT 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tzn | NP_730568.1 | PLN02469 | 90..347 | CDD:178088 | 42/210 (20%) |
hydroxyacylglutathione_hydrolase_MBL-fold | 93..263 | CDD:293809 | 39/202 (19%) | ||
HAGH_C | 264..344 | CDD:292741 | 1/3 (33%) | ||
mblac2 | NP_001116739.1 | GloB | 15..240 | CDD:223565 | 48/225 (21%) |
MBLAC2-like_MBL-fold | 22..227 | CDD:293798 | 45/220 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170593963 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0491 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |