DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and ethe1

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_998094.1 Gene:ethe1 / 405865 ZFINID:ZDB-GENE-040426-2503 Length:279 Species:Danio rerio


Alignment Length:222 Identity:67/222 - (30%)
Similarity:96/222 - (43%) Gaps:54/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YMYLIVDTKTREAAVVDPVEPELV---IKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKEL 163
            |.||:.|..||||.::||| .|.|   ::.:|:..|.|:..|.||.|.||..|...|.|      
Zfish    63 YTYLLADPDTREAVLIDPV-LETVDRDLQLIQQLGLNLTVALNTHCHADHITGTGLLKK------ 120

  Fly   164 DVYGGDDRI-----GALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTG 223
            .|:|....|     .|.:.::...|:.|.|...:....||.||.|.:.| :|..|    ...|||
Zfish   121 KVFGLKSGISKHSGAAADIQLSDGDSITFGKHCLMVRETPGHTDGCVTY-VTGDQ----RMAFTG 180

  Fly   224 DTLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQR 286
            |.|...||||  |.:|:|..:||::..|:.:||....::..|:|..|.:                
Zfish   181 DALLIRGCGRTDFQQGSPHRLYESVHQKIFSLPGHCFIYPAHDYKGQTV---------------- 229

  Fly   287 IEWAKHRRASQDPTVPSTIGEEKSWNP 313
                            ||:.|||.:||
Zfish   230 ----------------STVDEEKKFNP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 67/222 (30%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 57/170 (34%)
HAGH_C 264..344 CDD:292741 9/50 (18%)
ethe1NP_998094.1 PLN02962 51..278 CDD:178547 67/222 (30%)
POD-like_MBL-fold 51..224 CDD:293810 58/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.