DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and CG30022

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_725047.2 Gene:CG30022 / 36233 FlyBaseID:FBgn0050022 Length:279 Species:Drosophila melanogaster


Alignment Length:235 Identity:66/235 - (28%)
Similarity:100/235 - (42%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YMYLIVDTKTREAAVVDPV--EPELVIKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELD 164
            |.||:.|.|..:|.::|||  :.:...:.|::....|...:.||.|.||..|:..|.||      
  Fly    61 YSYLLADLKNGQAVIIDPVLEQAKRDAQLVKDLGFELKYAINTHMHADHITGSGWLRKL------ 119

  Fly   165 VYGGDDRIGA-----LNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGD 224
             .|....|.|     .::.:.:.|....|...:..|:||.||.|.:.|.|..|     |.|||||
  Fly   120 -TGCQSVIAAASGAKADRHLNEGDRIDFGTHVIDALATPGHTNGCMTYVIKDQ-----GCVFTGD 178

  Fly   225 TLFQGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQRI 287
            ||...||||  |.||.|..:||.:.:|:..||:..:::..|:|..|                   
  Fly   179 TLLIRGCGRTDFQEGCPRNLYENVHSKIFTLPENFRIYPAHDYKGQ------------------- 224

  Fly   288 EWAKHRRASQDPTVPSTIGEEKSWNP--------FMRVHE 319
                         :.|::.|||.:||        |:::.|
  Fly   225 -------------MESSVWEEKRYNPRLTKDIEEFVKIME 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 66/235 (28%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 55/169 (33%)
HAGH_C 264..344 CDD:292741 10/64 (16%)
CG30022NP_725047.2 PLN02962 45..277 CDD:178547 66/235 (28%)
POD-like_MBL-fold 49..221 CDD:293810 56/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.