DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and Lactb2

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_663356.1 Gene:Lactb2 / 212442 MGIID:2442551 Length:288 Species:Mus musculus


Alignment Length:253 Identity:54/253 - (21%)
Similarity:102/253 - (40%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MHSTLEDV-QLEGMEIKIL------PALQDNYMYLIVDTKTREAAVVDPVEPEL------VIKTV 129
            |.:.|:.: ||....:::|      ..||....|| |.|.:|. .::|..||.:      :.:.:
Mouse     1 MAAALQRIEQLSSRVVRVLGCNPGPMTLQGTNTYL-VGTGSRR-ILIDTGEPSVPEYISCLKQAL 63

  Fly   130 QEQQLTLSKVLTTHHHWDHAGG---------NE------KLLKLWEKELDVYGGDDRIGALNKKV 179
            .|....:.::|.||.|.||:||         |:      ||.:..::|..:..|:.:.    ..:
Mouse    64 VEFDTAIQEILVTHWHSDHSGGIVDICKNINNDTTYCIKKLRRNPQREEIIGNGEQQF----IYI 124

  Fly   180 QQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMYE 244
            :..|.....|..::.|.||.||..|:...:     ..|.|:|:||.:...|...|     |::|:
Mouse   125 ENGDVVKTEGATLRVLYTPGHTDDHMALLL-----EEENAIFSGDCILGEGTTIF-----EDLYD 179

  Fly   245 ALCTKLSALP-DATKVFCGHEYTLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTV 301
            .:.:..:.|. .|..::.||...:.|..            .:.:|:..||...::..:
Mouse   180 YMNSLNNLLKIKANIIYPGHGPVIHNAE------------AKILEYISHRNNREEQII 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 50/240 (21%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 44/197 (22%)
HAGH_C 264..344 CDD:292741 4/38 (11%)
Lactb2NP_663356.1 LACTB2-like_MBL-fold 14..203 CDD:293808 46/204 (23%)
GloB 23..223 CDD:223565 49/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.