DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and ethe-1

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_501684.1 Gene:ethe-1 / 177783 WormBaseID:WBGene00007886 Length:237 Species:Caenorhabditis elegans


Alignment Length:251 Identity:67/251 - (26%)
Similarity:98/251 - (39%) Gaps:70/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YMYLIVDTKTREAAVVDPVEPELV--IKTVQEQQLTLSKVLTTHHHWDHAGGNEKLLKLWEKELD 164
            |.|:|...||.:|.::|||...:.  |:.:::..|.|...|.||.|.||..|...|..::.....
 Worm    22 YTYIIGCHKTGKAVIIDPVVDTVSRDIQIIRDLNLDLIYGLNTHVHADHITGTNSLKTVFPTMKS 86

  Fly   165 VYGGDDRIGALNKKVQQDDTFTIGGLHVKCLSTPCHTTGHICY--HITAQQGSGEGAVFTGDTLF 227
            |...... |..:|.|...:...||||.::...||.||.|.:.|  |...       :.||||.|.
 Worm    87 VLSSKSG-GEADKYVSDGEIIEIGGLKLEVRETPGHTNGCLTYVEHSLR-------SAFTGDALL 143

  Fly   228 QGGCGR--FFEGTPEEMYEALCTKLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQRIEWA 290
            ...|||  |.:|.|..:::::..|:..||:...|:.||.|              |.|:|      
 Worm   144 IRACGRTDFQQGNPASLFDSVHDKIFTLPEDYVVYVGHNY--------------NGVLQ------ 188

  Fly   291 KHRRASQDPTVPSTIGEEKSWNPFMRVHEATVQKHAGGATDPVVTMGKLRKEKDTF 346
                        :|:.|||:.||                        :|.|.||.|
 Worm   189 ------------TTVWEEKNLNP------------------------RLTKSKDQF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 67/251 (27%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 50/166 (30%)
HAGH_C 264..344 CDD:292741 12/79 (15%)
ethe-1NP_501684.1 PLN02962 10..234 CDD:178547 67/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.