Sequence 1: | NP_730568.1 | Gene: | tzn / 40299 | FlyBaseID: | FBgn0037024 | Length: | 348 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_981951.2 | Gene: | MBLAC2 / 153364 | HGNCID: | 33711 | Length: | 279 | Species: | Homo sapiens |
Alignment Length: | 218 | Identity: | 47/218 - (21%) |
---|---|---|---|
Similarity: | 78/218 - (35%) | Gaps: | 63/218 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 EDVQLE-GMEIKILPALQDNYMY---LIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTH 143
Fly 144 HHWDHAGG-------------NEKLLK-------LWEKELDVY--------GGDDRIGALNKK-- 178
Fly 179 VQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMY 243
Fly 244 EALCTKLSALPD---ATKVFCGH 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tzn | NP_730568.1 | PLN02469 | 90..347 | CDD:178088 | 44/210 (21%) |
hydroxyacylglutathione_hydrolase_MBL-fold | 93..263 | CDD:293809 | 42/205 (20%) | ||
HAGH_C | 264..344 | CDD:292741 | 47/218 (22%) | ||
MBLAC2 | NP_981951.2 | MBLAC2-like_MBL-fold | 22..231 | CDD:293798 | 45/216 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165158092 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0491 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |