DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tzn and MBLAC2

DIOPT Version :9

Sequence 1:NP_730568.1 Gene:tzn / 40299 FlyBaseID:FBgn0037024 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_981951.2 Gene:MBLAC2 / 153364 HGNCID:33711 Length:279 Species:Homo sapiens


Alignment Length:218 Identity:47/218 - (21%)
Similarity:78/218 - (35%) Gaps:63/218 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EDVQLE-GMEIKILPALQDNYMY---LIVDTKTREAAVVDPVEPELVIKTVQEQQLTLSKVLTTH 143
            :||.:: |:.::.||    .|:|   |:.|.:.:|.|...|:                 ..:.||
Human    40 QDVVIDTGLGLRSLP----EYLYSSGLLQDREAKEDAARRPL-----------------LAVATH 83

  Fly   144 HHWDHAGG-------------NEKLLK-------LWEKELDVY--------GGDDRIGALNKK-- 178
            .|:||:||             .|.|.:       .|..:.:|.        ....|:.|:...  
Human    84 VHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRTPSPGWRARQFRVQAVQPTLI 148

  Fly   179 VQQDDTFTIGGLHVKCLSTPCHTTGHICYHITAQQGSGEGAVFTGDTLFQGGCGRFFEGTPEEMY 243
            :|..|...:|...:..:..|.|:.|.||.|     ......:|:||.::.|....:...:....|
Human   149 LQDGDVINLGDRQLTVMHMPGHSRGSICLH-----DKDRKILFSGDVVYDGSLIDWLPYSRISDY 208

  Fly   244 EALCTKLSALPD---ATKVFCGH 263
            ...|.:|..|.|   ..||..||
Human   209 VGTCERLIELVDRGLVEKVLPGH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tznNP_730568.1 PLN02469 90..347 CDD:178088 44/210 (21%)
hydroxyacylglutathione_hydrolase_MBL-fold 93..263 CDD:293809 42/205 (20%)
HAGH_C 264..344 CDD:292741 47/218 (22%)
MBLAC2NP_981951.2 MBLAC2-like_MBL-fold 22..231 CDD:293798 45/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.