DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and KNAT2

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001320784.1 Gene:KNAT2 / 843388 AraportID:AT1G70510 Length:314 Species:Arabidopsis thaliana


Alignment Length:377 Identity:74/377 - (19%)
Similarity:128/377 - (33%) Gaps:151/377 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TNDYDKSPPPTASTTPTHYPSLNSIIFENGSSGNL---GDLNGNTKTDLCAGLQRSGGGLGGNAG 151
            |.||.:.   .....|:.|.||  |....|.:..|   .:|.....::|...::::.        
plant    10 TEDYSEK---ATLMMPSDYQSL--ICSTTGDNQRLFGSDELATALSSELLPRIRKAE-------- 61

  Fly   152 SGGHLISNLTAAHNMSAVSSFPIDAKMLQFSTD--------QIQCMCEALQQ-----KGDIEKLT 203
                  .|.:.:...|.::|.|:..::||...|        :|.|:.|.:|:     |.|:..|:
plant    62 ------DNFSLSVIKSKIASHPLYPRLLQTYIDCQKVGAPMEIACILEEIQRENHVYKRDVAPLS 120

  Fly   204 TFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETHC-FSIKYHVD------------- 254
            .|.......||            ||::           .||:| ..:||..|             
plant   121 CFGADPELDEF------------MVSH-----------FETYCDILVKYKTDLARPFDEATTFIN 162

  Fly   255 -----LQNLWF---------------------------------KAHYKEAEKVRGRPLGA-VDK 280
                 ||||..                                 :::.::.:....|..|: :..
plant   163 KIEMQLQNLCTGPASATALSDDGAVSSDEELREDDDIAADDSQQRSNDRDLKDQLLRKFGSHISS 227

  Fly   281 YRL-----RKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNR---YPTPDEKKTLAKKTGLTL 337
            .:|     :||..||:              ::|.||.|.:..:.   |||..:|.:||::|||..
plant   228 LKLEFSKKKKKGKLPR--------------EARQALLDWWNVHNKWPYPTEGDKISLAEETGLDQ 278

  Fly   338 TQVSNWFKNRRQRDRTPQQRPDIMSVLPVGQLDGNGFPRMFNAPSYYPETIF 389
            .|::|||.|:|:|...|.:.      :|...:|.:.            ||.|
plant   279 KQINNWFINQRKRHWKPSEN------MPFDMMDDSN------------ETFF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 28/179 (16%)
homeodomain 301..355 CDD:238039 20/56 (36%)
KNAT2NP_001320784.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.