powered by:
Protein Alignment Six4 and KNAT7
DIOPT Version :9
Sequence 1: | NP_649256.1 |
Gene: | Six4 / 40297 |
FlyBaseID: | FBgn0027364 |
Length: | 392 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_564805.1 |
Gene: | KNAT7 / 842602 |
AraportID: | AT1G62990 |
Length: | 291 |
Species: | Arabidopsis thaliana |
Alignment Length: | 32 |
Identity: | 17/32 - (53%) |
Similarity: | 25/32 - (78%) |
Gaps: | 0/32 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 320 YPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRD 351
|||.|:|..|.::|||.|.|::|||.|:|:|:
plant 243 YPTEDDKAKLVEETGLQLKQINNWFINQRKRN 274
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
78 |
1.000 |
Inparanoid score |
I2393 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.050 |
|
Return to query results.
Submit another query.