DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and KNAT7

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_564805.1 Gene:KNAT7 / 842602 AraportID:AT1G62990 Length:291 Species:Arabidopsis thaliana


Alignment Length:32 Identity:17/32 - (53%)
Similarity:25/32 - (78%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 YPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRD 351
            |||.|:|..|.::|||.|.|::|||.|:|:|:
plant   243 YPTEDDKAKLVEETGLQLKQINNWFINQRKRN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483
homeodomain 301..355 CDD:238039 17/32 (53%)
KNAT7NP_564805.1 KNOX1 29..67 CDD:281744
KNOX2 84..134 CDD:281745
Homeobox_KN 234..273 CDD:283551 16/29 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.