DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and KNAT6

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_173752.3 Gene:KNAT6 / 838946 AraportID:AT1G23380 Length:329 Species:Arabidopsis thaliana


Alignment Length:357 Identity:74/357 - (20%)
Similarity:122/357 - (34%) Gaps:127/357 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DY-DKS---PPPTASTTPTHYPSLNSIIFENGSSGNLGDLNGNTKTDLCAGLQRSGGGLGGNAGS 152
            || |||   ..|.:...|:.|.:|   :..:.....:.|:.|:.:.     |..:...|...|.|
plant    12 DYSDKSVLMMSPESLMFPSDYQAL---LCSSAGENRVSDVFGSDEL-----LSVAVSALSSEAAS 68

  Fly   153 GGHLI----SNLTAAHNMSAVSSFPIDAKMLQFSTD----------QIQCMCEALQQKGDIEKLT 203
            ....|    .|::.....:.::..|...::||...|          :|.|:.|.:|::.|:.|. 
plant    69 IAPEIRRNDDNVSLTVIKAKIACHPSYPRLLQAYIDCQKKQVGAPPEIACLLEEIQRESDVYKQ- 132

  Fly   204 TFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELY-NLL------------ETHCFSIKYHVDL 255
                .:.||..|..:.           .|.:|.|.| ::|            |..||..|..:.|
plant   133 ----EVVPSSCFGADP-----------ELDEFMETYCDILVKYKSDLARPFDEATCFLNKIEMQL 182

  Fly   256 QNLWFKAHYKEAEKVRG--------------------------------------RPLGA----- 277
            :||     ....|..||                                      |..|:     
plant   183 RNL-----CTGVESARGVSEDGVISSDEELSGGDHEVAEDGRQRCEDRDLKDRLLRKFGSRISTL 242

  Fly   278 -VDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTN---RYPTPDEKKTLAKKTGLTLT 338
             ::..:.:||..||:              ::|.||.|.:..:   .|||..:|..||..|||...
plant   243 KLEFSKKKKKGKLPR--------------EARQALLDWWNLHYKWPYPTEGDKIALADATGLDQK 293

  Fly   339 QVSNWFKNRRQRDRTPQQRPDIMSVLPVGQLD 370
            |::|||.|:|:|...|.:.      :|...:|
plant   294 QINNWFINQRKRHWKPSEN------MPFAMMD 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 29/175 (17%)
homeodomain 301..355 CDD:238039 20/56 (36%)
KNAT6NP_173752.3 KNOX1 85..125 CDD:397730 7/39 (18%)
KNOX2 139..186 CDD:397731 13/62 (21%)
ELK 226..247 CDD:397729 2/20 (10%)
Homeobox_KN 266..305 CDD:399131 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.