DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and KNAT3

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_197904.1 Gene:KNAT3 / 832593 AraportID:AT5G25220 Length:431 Species:Arabidopsis thaliana


Alignment Length:366 Identity:73/366 - (19%)
Similarity:123/366 - (33%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RFQDITNDYDKSPPPTASTT----------------PTHYPSLNSIIFENGSSGN-------LGD 126
            |..|..|::......||:||                ...:.|.:|...:..::.|       :.|
plant    54 RSSDNNNNFLNLHTATANTTTASSSDSPSSAAAAAAANQWLSRSSSFLQRNNNNNASIVGDGIDD 118

  Fly   127 LNGNTKTDLCAGLQRSGGGLGGNAGSGGHLISNLTA---AHNMSAVSSFPIDAKMLQFSTDQIQC 188
            :.|...| :..|..::|||...|.|.|......:.:   |.:.:.:.|.|:..::|   :..:.|
plant   119 VTGGADT-MIQGEMKTGGGENKNDGGGATAADGVVSWQNARHKAEILSHPLYEQLL---SAHVAC 179

  Fly   189 MCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAY----NLGQFHELYNLLETHCF-- 247
                |:....:::|......|..|:......|.|.|.|....    .|.||...|.||  .|.  
plant   180 ----LRIATPVDQLPRIDAQLAQSQHVVAKYSALGAAAQGLVGDDKELDQFMTHYVLL--LCSFK 238

  Fly   248 -SIKYHVDLQNLWFKAHYKEAEKV---------------RGRPLGAVDKYRLRKKYPLPKTIWDG 296
             .::.||       :.|..||...               .|..:||.......::......::||
plant   239 EQLQQHV-------RVHAMEAVMACWEIEQSLQSLTGVSPGEGMGATMSDDEDEQVESDANMFDG 296

  Fly   297 EETVYCF----------------KEKSRNALKDCY-----------LTNR--------------- 319
            ...|..|                :::.::.||..|           |..|               
plant   297 GLDVLGFGPLIPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKA 361

  Fly   320 ---------YPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRD 351
                     |||.::|..|.::|||.|.|::|||.|:|:|:
plant   362 WWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 24/130 (18%)
homeodomain 301..355 CDD:238039 22/102 (22%)
KNAT3NP_197904.1 KNOX1 160..197 CDD:281744 6/43 (14%)
KNOX2 217..267 CDD:281745 12/58 (21%)
ELK 322..343 CDD:281743 3/20 (15%)
Homeobox_KN 362..401 CDD:283551 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.