DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and KNAT4

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_196667.2 Gene:KNAT4 / 830973 AraportID:AT5G11060 Length:393 Species:Arabidopsis thaliana


Alignment Length:390 Identity:77/390 - (19%)
Similarity:133/390 - (34%) Gaps:155/390 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FQDITNDYDKSPPP-------------------------------------TASTTPT-----HY 108
            |...|:.....|||                                     |:|.:|:     .:
plant     8 FNHFTDQQQHQPPPPPQQQQQQHFQESAPPNWLLRSDNNFLNLHTAASAAATSSDSPSSAAANQW 72

  Fly   109 PSLNSIIFENGSSGNLGDLNGNTKTDLCAGLQRSGGGLGG---------NAGSGGHLISN----- 159
            .|.:|...:.|::.|  :.|..|..|:...:......:.|         ||.....::|:     
plant    73 LSRSSSFLQRGNTAN--NNNNETSGDVIEDVPGGEESMIGEKKEAERWQNARHKAEILSHPLYEQ 135

  Fly   160 LTAAH-----NMSAVSSFP-IDAKMLQ-------FSTDQIQCMCEALQ--QKGDIEKLTTF---- 205
            |.:||     ..:.|...| |||::.|       :||      .||.|  ..||.::|..|    
plant   136 LLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYST------LEAAQGLLAGDDKELDHFMTHY 194

  Fly   206 ---LCSLPPSEFFKTNESVLRARAMVA----YNLGQFHELYNLL--------------------E 243
               |||     |.:..:..:|..||.|    :.:.|..:.:..:                    :
plant   195 VLLLCS-----FKEQLQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESD 254

  Fly   244 THCFSIKYHVDLQNLWF------KAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYC 302
            .|.|.    ..|..|.|      ::.....|:||...     |:.|::.|         :|.:..
plant   255 AHLFD----GSLDGLGFGPLVPTESERSLMERVRQEL-----KHELKQGY---------KEKIVD 301

  Fly   303 FKEK-------------SRNALKDCYLTNR---YPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRD 351
            .:|:             :.:.||..:.::.   |||.::|..|.::|||.|.|::|||.|:|:|:
plant   302 IREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN 366

  Fly   352  351
            plant   367  366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 29/147 (20%)
homeodomain 301..355 CDD:238039 19/67 (28%)
KNAT4NP_196667.2 KNOX1 124..161 CDD:281744 9/36 (25%)
KNOX2 182..231 CDD:281745 13/53 (25%)
ELK 286..307 CDD:281743 5/34 (15%)
Homeobox_KN 326..365 CDD:283551 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.