DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and six5

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571795.1 Gene:six5 / 65235 ZFINID:ZDB-GENE-010201-3 Length:797 Species:Danio rerio


Alignment Length:187 Identity:122/187 - (65%)
Similarity:150/187 - (80%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPS-EFFKTNESVLRARAMVAYNL 232
            :.||...|  |.|||||:.|:||||.|.|::::|..||.::||| :..:.||::|:|:|:||::.
Zfish    40 LQSFQNSA--LSFSTDQVACLCEALLQAGNVDRLWRFLATIPPSADLLRGNETLLKAQALVAFHR 102

  Fly   233 GQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGE 297
            .:|.|||.:|::|.|....|..||:|:.||.|||||:.|||.||||||||||||:||||||||||
Zfish   103 DEFKELYAILDSHDFHPSNHGFLQDLYLKARYKEAERSRGRSLGAVDKYRLRKKFPLPKTIWDGE 167

  Fly   298 ETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTP 354
            |||||||||||||||:||..||||||.|||.|||.|||:||||||||||||||||||
Zfish   168 ETVYCFKEKSRNALKECYKINRYPTPAEKKNLAKVTGLSLTQVSNWFKNRRQRDRTP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 59/109 (54%)
homeodomain 301..355 CDD:238039 47/54 (87%)
six5NP_571795.1 SIX1_SD 50..160 CDD:293483 59/109 (54%)
homeodomain 171..222 CDD:238039 43/50 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7299
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26080
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.