DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and six4b

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571792.2 Gene:six4b / 65232 ZFINID:ZDB-GENE-010201-1 Length:615 Species:Danio rerio


Alignment Length:194 Identity:119/194 - (61%)
Similarity:148/194 - (76%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLE 243
            |.||.:|:.|:||||.|.|::::|..||.|||.|:..:.|||:|:|:|:||::..::.|||.:||
Zfish    63 LAFSPEQVACVCEALMQGGNVDRLARFLWSLPQSDLLRGNESILKAQAIVAFHHARYQELYCILE 127

  Fly   244 THCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSR 308
            .|.||...|..||::|:||.|.||||.||||||||||||||:|||||:||||||||||||||:||
Zfish   128 NHSFSPSNHSSLQDMWYKARYTEAEKARGRPLGAVDKYRLRRKYPLPRTIWDGEETVYCFKERSR 192

  Fly   309 NALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQRPDIMSVLPVGQLDGN 372
            |||||.|..||||:|.||:.|||.|||:||||||||||||||||.|.:...      ..:.|||
Zfish   193 NALKDMYKRNRYPSPAEKRNLAKMTGLSLTQVSNWFKNRRQRDRNPSEAQS------KSESDGN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 61/108 (56%)
homeodomain 301..355 CDD:238039 42/53 (79%)
six4bNP_571792.2 SIX1_SD 65..174 CDD:293483 61/108 (56%)
homeodomain 185..239 CDD:238039 42/53 (79%)
E_Pc_C <395..>478 CDD:284226
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26080
orthoMCL 1 0.900 - - OOG6_109892
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
88.270

Return to query results.
Submit another query.