DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and ANHX

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006719806.1 Gene:ANHX / 647589 HGNCID:40024 Length:492 Species:Homo sapiens


Alignment Length:220 Identity:60/220 - (27%)
Similarity:86/220 - (39%) Gaps:50/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 MCEALQQKGDIEKLTTFLCSLPPSEF---FKTNESVLRARAMVAYNLGQFHELYNLLETHCFSIK 250
            :|...|.  |:.:|...:.::..|:.   ...|..|..|.|.|.....|......||| .|....
Human    28 LCRDFQD--DLAQLQPLVTAILDSQLRLHLLDNADVALACARVLDQQEQQQAACRLLE-GCQVPG 89

  Fly   251 YHVDLQNLWFKAHYKEAEKVRG-RPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKE-KSRNALKD 313
            ...:|..||...||:...:..| ..|..|.|:|.||:.|.|.::        |.:. ||||..::
Human    90 GSQELVQLWNDIHYRLVMRRLGVAALTPVQKFRCRKRNPPPPSL--------CPEGLKSRNFPRE 146

  Fly   314 --------CYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT------PQQR------- 357
                    ....|..|:..|::.||.:|.||..||.|||.|.|:|.|.      |.|:       
Human   147 VREKLHNFAVGVNTNPSKAERENLALETSLTPEQVYNWFANYRRRQRALPQHMKPAQQATAEDPG 211

  Fly   358 -----PDIMSVLPVGQLDGNGFPRM 377
                 ||::      |..||  ||:
Human   212 ARERGPDLL------QPSGN--PRV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 28/104 (27%)
homeodomain 301..355 CDD:238039 22/68 (32%)
ANHXXP_006719806.1 SIX1_SD <79..130 CDD:293483 17/51 (33%)
homeodomain 139..193 CDD:238039 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.