DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Six4 and six2b

DIOPT Version :9

Sequence 1:NP_649256.1 Gene:Six4 / 40297 FlyBaseID:FBgn0027364 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001122206.1 Gene:six2b / 566454 ZFINID:ZDB-GENE-080723-23 Length:285 Species:Danio rerio


Alignment Length:177 Identity:111/177 - (62%)
Similarity:135/177 - (76%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETH 245
            |:.:|:.|:||.|||.|.||:|..||.|||..|....|||||:|:|:||::.|.|.|||.:||:|
Zfish     9 FTQEQVACVCEVLQQGGSIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKVLESH 73

  Fly   246 CFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNA 310
            .||...|..||.||.||||.||||:||||||||.|||:|:|:|||::|||||||.||||||||..
Zfish    74 QFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRCV 138

  Fly   311 LKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357
            ||:.|..|.||:|.||:.||:.||||.|||||||||||||||..:.:
Zfish   139 LKEWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Six4NP_649256.1 SIX1_SD 181..290 CDD:293483 64/108 (59%)
homeodomain 301..355 CDD:238039 38/53 (72%)
six2bNP_001122206.1 SIX1_SD 9..118 CDD:293483 64/108 (59%)
homeodomain 129..180 CDD:238039 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.